Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T57700
|
||||
| Former ID |
TTDS00270
|
||||
| Target Name |
Mast/stem cell growth factor receptor
|
||||
| Gene Name |
KIT
|
||||
| Synonyms |
C-kit; CD117 antigen; Proto-oncogene tyrosine-protein kinase Kit; SCFR; KIT
|
||||
| Target Type |
Successful
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | |||||
| Advanced renal cell carcinoma [ICD9: 189; ICD10: C64] | |||||
| Chronic myelogenous leukaemia [ICD9: 205.1; ICD10: C92.1] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Glioma; Lung cancer; Prostate cancer; Solid tumours [ICD9: 140-199, 191, 210-229; ICD10: C00-C75, C71, C7A, C7B, D10-D36, D3A] | |||||
| Hepatocellular carcinoma; NSCLC; Melanoma [ICD9: 155, 162, 172; ICD10: C22.0, C33, C34, C43] | |||||
| Intestinal cancer; Myeloid leukemia [ICD9: 152, 153, 205; ICD10: C17, C18, C92] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Myelodysplastic syndrome; AML; Head and neck cancer; Breast cancer; Pancreatic cancer [ICD9: 140-149, 140-229, 157, 183, 205.0; ICD10: C07-C14, C25, C32, C33, C56, C92.0] | |||||
| Metastatic colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | |||||
| Non-small cell lung cancer [ICD10: C33-C34] | |||||
| Renal cancer [ICD9: 140-229, 189; ICD10: C64] | |||||
| Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
| Function |
Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mastcell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T57700
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.10.1
|
||||
| Sequence |
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV GSTASSSQPLLVHDDV |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Imatinib | Drug Info | Approved | Chronic myelogenous leukaemia | [536294], [541030] |
| Pazopanib HCl | Drug Info | Approved | Renal cancer | [530677] | |
| Ponatinib | Drug Info | Approved | Acute lymphoblastic leukemia | [532210], [541188] | |
| Regorafenib | Drug Info | Approved | Metastatic colorectal cancer | [532210], [541189] | |
| Sorafenib | Drug Info | Approved | Advanced renal cell carcinoma | [528230], [541050] | |
| Imatinib | Drug Info | Phase 3 | Intestinal cancer; Myeloid leukemia | [536294], [541030] | |
| PLX-3397 | Drug Info | Phase 3 | Alzheimer disease | [525099] | |
| Sorafenib | Drug Info | Phase 3 | Hepatocellular carcinoma; NSCLC; Melanoma | [537114], [541050] | |
| Famitinib | Drug Info | Phase 2 | Cancer | [532104], [542811] | |
| Imatinib | Drug Info | Phase 2 | Glioma; Lung cancer; Prostate cancer; Solid tumours | [536294], [541030] | |
| MP470 | Drug Info | Phase 2 | Solid tumours | [531617], [532785], [542847] | |
| Sorafenib | Drug Info | Phase 2 | Myelodysplastic syndrome; AML; Head and neck cancer; Breast cancer; Pancreatic cancer | [537114], [541050] | |
| XL-820 | Drug Info | Phase 2 | Solid tumours | [522178] | |
| AMG-191 | Drug Info | Phase 1 | Inflammatory disease | [548849] | |
| OSI-930 | Drug Info | Phase 1 | Solid tumours | [531624], [531955] | |
| Motesanib | Drug Info | Discontinued in Phase 3 | Non-small cell lung cancer | [541005], [546905] | |
| Inhibitor | 4-(4-aminophenyl)-1H-indazol-3yl-amine | Drug Info | [528716] | ||
| 5,11-Dimethyl-6H-pyrido[4,3-b]carbazol-9-ol | Drug Info | [527769] | |||
| 9-Bromo-5,11-dimethyl-6H-pyrido[4,3-b]carbazole | Drug Info | [527769] | |||
| 9-Methoxy-5,11-dimethyl-6H-pyrido[4,3-b]carbazole | Drug Info | [527769] | |||
| Adenosine-5'-Diphosphate | Drug Info | [551391] | |||
| AMG-191 | Drug Info | [548850] | |||
| APCK-110 | Drug Info | [543493] | |||
| AST-487 | Drug Info | [528954] | |||
| Bis-(5-hydroxy-1H-indol-2-yl)-methanone | Drug Info | [528209] | |||
| compound 7k | Drug Info | [532280] | |||
| compound 8h | Drug Info | [531959] | |||
| CP-673451 | Drug Info | [527429] | |||
| Famitinib | Drug Info | [532104] | |||
| GTP-14564 | Drug Info | [526648] | |||
| Imatinib | Drug Info | [536474] | |||
| JNJ-28312141 | Drug Info | [530495] | |||
| Ki-20227 | Drug Info | [528535] | |||
| Motesanib | Drug Info | [537551], [550250], [551087] | |||
| Pazopanib HCl | Drug Info | [530677] | |||
| PD-0166326 | Drug Info | [530497] | |||
| PD-0173956 | Drug Info | [530497] | |||
| Phosphonotyrosine | Drug Info | [551393] | |||
| PLX-3397 | Drug Info | [550447] | |||
| SEMAXINIB | Drug Info | [525812] | |||
| WBZ-7 | Drug Info | [543493] | |||
| XL-820 | Drug Info | [550402] | |||
| Modulator | MP470 | Drug Info | [531617], [532785] | ||
| OSI-930 | Drug Info | [531624], [531955] | |||
| Ponatinib | Drug Info | [551871] | |||
| Regorafenib | Drug Info | [551871] | |||
| Sorafenib | Drug Info | [528230] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| Pathways | |||||
| KEGG Pathway | Ras signaling pathway | ||||
| Rap1 signaling pathway | |||||
| Cytokine-cytokine receptor interaction | |||||
| Endocytosis | |||||
| PI3K-Akt signaling pathway | |||||
| Hematopoietic cell lineage | |||||
| Melanogenesis | |||||
| Pathways in cancer | |||||
| Acute myeloid leukemia | |||||
| Central carbon metabolism in cancer | |||||
| NetPath Pathway | IL3 Signaling Pathway | ||||
| IL4 Signaling Pathway | |||||
| KitReceptor Signaling Pathway | |||||
| Pathway Interaction Database | C-MYB transcription factor network | ||||
| Signaling events mediated by Stem cell factor receptor (c-Kit) | |||||
| Reactome | PIP3 activates AKT signaling | ||||
| Regulation of KIT signaling | |||||
| Constitutive Signaling by Aberrant PI3K in Cancer | |||||
| RAF/MAP kinase cascade | |||||
| WikiPathways | Kit receptor signaling pathway | ||||
| Differentiation Pathway | |||||
| Signaling by SCF-KIT | |||||
| PIP3 activates AKT signaling | |||||
| Cardiac Progenitor Differentiation | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| miR-targeted genes in epithelium - TarBase | |||||
| References | |||||
| Ref 522178 | ClinicalTrials.gov (NCT00570635) A Phase 2 Study of XL820 in Adults With Advanced GIST Resistant to Imatinib and/or Sunitinib. U.S. National Institutes of Health. | ||||
| Ref 525099 | ClinicalTrials.gov (NCT02371369) PLX3397 Phase 3 Study for Pigmented Villonodular Synovitis (PVNS) or Giant Cell Tumor of the Tendon Sheath (GCT-TS). U.S. National Institutes of Health. | ||||
| Ref 528230 | Sorafenib (BAY 43-9006, Nexavar), a dual-action inhibitor that targets RAF/MEK/ERK pathway in tumor cells and tyrosine kinases VEGFR/PDGFR in tumor vasculature. Methods Enzymol. 2006;407:597-612. | ||||
| Ref 531617 | The receptor tyrosine kinase inhibitor amuvatinib (MP470) sensitizes tumor cells to radio- and chemo-therapies in part by inhibiting homologous recombination. Radiother Oncol. 2011 Oct;101(1):59-65. | ||||
| Ref 531624 | Inhibition of c-Kit, VEGFR-2 (KDR), and ABCG2 by analogues of OSI-930. Bioorg Med Chem Lett. 2011 Nov 1;21(21):6495-9. | ||||
| Ref 531955 | OSI-930 analogues as novel reversal agents for ABCG2-mediated multidrug resistance. Biochem Pharmacol. 2012 Sep 15;84(6):766-74. | ||||
| Ref 532104 | Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706. | ||||
| Ref 532785 | Phase 1B study of amuvatinib in combination with five standard cancer therapies in adults with advanced solid tumors. Cancer Chemother Pharmacol. 2014 Jul;74(1):195-204. | ||||
| Ref 536294 | Emerging treatments for pulmonary arterial hypertension. Expert Opin Emerg Drugs. 2006 Nov;11(4):609-19. | ||||
| Ref 541005 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5660). | ||||
| Ref 541030 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5687). | ||||
| Ref 541050 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5711). | ||||
| Ref 541188 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5890). | ||||
| Ref 541189 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5891). | ||||
| Ref 542811 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7886). | ||||
| Ref 542847 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7932). | ||||
| Ref 525812 | J Med Chem. 2000 Jun 15;43(12):2310-23.New anilinophthalazines as potent and orally well absorbed inhibitors of the VEGF receptor tyrosine kinases useful as antagonists of tumor-driven angiogenesis. | ||||
| Ref 526648 | Selective cytotoxic mechanism of GTP-14564, a novel tyrosine kinase inhibitor in leukemia cells expressing a constitutively active Fms-like tyrosine kinase 3 (FLT3). J Biol Chem. 2003 Aug 29;278(35):32892-8. Epub 2003 Jun 18. | ||||
| Ref 527429 | Antiangiogenic and antitumor activity of a selective PDGFR tyrosine kinase inhibitor, CP-673,451. Cancer Res. 2005 Feb 1;65(3):957-66. | ||||
| Ref 527769 | J Med Chem. 2005 Oct 6;48(20):6194-201.Molecular modeling of wild-type and D816V c-Kit inhibition based on ATP-competitive binding of ellipticine derivatives to tyrosine kinases. | ||||
| Ref 528209 | J Med Chem. 2006 Jun 1;49(11):3101-15.Novel bis(1H-indol-2-yl)methanones as potent inhibitors of FLT3 and platelet-derived growth factor receptor tyrosine kinase. | ||||
| Ref 528230 | Sorafenib (BAY 43-9006, Nexavar), a dual-action inhibitor that targets RAF/MEK/ERK pathway in tumor cells and tyrosine kinases VEGFR/PDGFR in tumor vasculature. Methods Enzymol. 2006;407:597-612. | ||||
| Ref 528535 | A c-fms tyrosine kinase inhibitor, Ki20227, suppresses osteoclast differentiation and osteolytic bone destruction in a bone metastasis model. Mol Cancer Ther. 2006 Nov;5(11):2634-43. | ||||
| Ref 528716 | J Med Chem. 2007 Apr 5;50(7):1584-97. Epub 2007 Mar 8.Discovery of N-(4-(3-amino-1H-indazol-4-yl)phenyl)-N'-(2-fluoro-5-methylphenyl)urea (ABT-869), a 3-aminoindazole-based orally active multitargeted receptor tyrosine kinase inhibitor. | ||||
| Ref 528954 | The RET kinase inhibitor NVP-AST487 blocks growth and calcitonin gene expression through distinct mechanisms in medullary thyroid cancer cells. Cancer Res. 2007 Jul 15;67(14):6956-64. | ||||
| Ref 530495 | JNJ-28312141, a novel orally active colony-stimulating factor-1 receptor/FMS-related receptor tyrosine kinase-3 receptor tyrosine kinase inhibitor with potential utility in solid tumors, bone metastases, and acute myeloid leukemia. Mol Cancer Ther. 2009 Nov;8(11):3151-61. | ||||
| Ref 530497 | Bioorg Med Chem Lett. 2009 Dec 15;19(24):6872-6. Epub 2009 Oct 23.Structure-activity relationships of 6-(2,6-dichlorophenyl)-8-methyl-2-(phenylamino)pyrido[2,3-d]pyrimidin-7-ones: toward selective Abl inhibitors. | ||||
| Ref 531617 | The receptor tyrosine kinase inhibitor amuvatinib (MP470) sensitizes tumor cells to radio- and chemo-therapies in part by inhibiting homologous recombination. Radiother Oncol. 2011 Oct;101(1):59-65. | ||||
| Ref 531624 | Inhibition of c-Kit, VEGFR-2 (KDR), and ABCG2 by analogues of OSI-930. Bioorg Med Chem Lett. 2011 Nov 1;21(21):6495-9. | ||||
| Ref 531955 | OSI-930 analogues as novel reversal agents for ABCG2-mediated multidrug resistance. Biochem Pharmacol. 2012 Sep 15;84(6):766-74. | ||||
| Ref 531959 | The design, synthesis, and biological evaluation of potent receptor tyrosine kinase inhibitors. Bioorg Med Chem Lett. 2012 Aug 1;22(15):4979-85. | ||||
| Ref 532104 | Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706. | ||||
| Ref 532280 | Discovery and optimization of 3-(2-(Pyrazolo[1,5-a]pyrimidin-6-yl)ethynyl)benzamides as novel selective and orally bioavailable discoidin domain receptor 1 (DDR1) inhibitors. J Med Chem. 2013 Apr 25;56(8):3281-95. | ||||
| Ref 532785 | Phase 1B study of amuvatinib in combination with five standard cancer therapies in adults with advanced solid tumors. Cancer Chemother Pharmacol. 2014 Jul;74(1):195-204. | ||||
| Ref 536474 | A comparison of physicochemical property profiles of marketed oral drugs and orally bioavailable anti-cancer protein kinase inhibitors in clinical development. Curr Top Med Chem. 2007;7(14):1408-22. | ||||
| Ref 537551 | Phase II study of safety and efficacy of motesanib in patients with progressive or symptomatic, advanced or metastatic medullary thyroid cancer. J Clin Oncol. 2009 Aug 10;27(23):3794-801. Epub 2009 Jun 29. | ||||
| Ref 543493 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1805). | ||||
| Ref 548850 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029529) | ||||
| Ref 551391 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
