Target General Infomation
Target ID
T61698
Former ID
TTDR00141
Target Name
Interleukin-2
Gene Name
IL2
Synonyms
Aldesleukin; IL-2; T-cell growth factor; TCGF; IL2
Target Type
Successful
Disease Bipolar disorder [ICD9: 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F31, F40-F42]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Chronic lymphocytic leukaemia [ICD10: C91]
Diabetes [ICD9: 253.5, 588.1; ICD10: E23.2, N25.1]
Immuno-stimulant [ICD10: C00-C97]
Lung cancer [ICD9: 162; ICD10: C33-C34]
Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86]
Multiple scierosis [ICD9: 340; ICD10: G35]
Melanoma [ICD9: 172; ICD10: C43]
Metastatic renal cell carcer [ICD9: 189; ICD10: C64]
Non-hodgkin's lymphoma [ICD10: C85]
Ovarian cancer [ICD9: 183; ICD10: C56]
Prostate cancer [ICD9: 185; ICD10: C61]
Renal cancer [ICD9: 140-229, 189; ICD10: C64]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
Unspecified [ICD code not available]
Function
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine- activated killer cells, natural killer cells, and glioma cells.
BioChemical Class
Cytokine: interleukin
UniProt ID
Sequence
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
Drugs and Mode of Action
Drug(s) Aldesleukin Drug Info Approved Metastatic renal cell carcer [536361]
Daclizumab Drug Info Approved Multiple scierosis [889440]
AIR-insulin Drug Info Phase 3 Diabetes [551855]
TG-4010 Drug Info Phase 2/3 Bipolar disorder [529572]
Aldesleukin Drug Info Phase 2 Non-hodgkin's lymphoma [536361]
APN-301 Drug Info Phase 2 Melanoma [522201]
Human interleukin-2 Drug Info Phase 2 Renal cancer [551015]
IL-2/CD40L-expressing leukemia vaccine Drug Info Phase 2 Chronic lymphocytic leukaemia [523912]
L19-IL-2 fusion protein Drug Info Phase 2 Lymphoma [548544]
Leuvectin Drug Info Phase 2 Melanoma [521459]
Thymoctonan Drug Info Phase 2 Immuno-stimulant [521442]
IL-2 XL Drug Info Phase 1/2 Renal cancer [547897]
IL-2/gene-modified lymphocytes Drug Info Phase 1/2 Ovarian cancer [521558]
Medusa IL-2 Drug Info Phase 1/2 Cancer [549990]
VCL-1M01 Drug Info Phase 1 Melanoma [521725]
VPM-4-001 Drug Info Preclinical Prostate cancer [548240]
Nuleusin Drug Info Discontinued in Phase 3 Melanoma [548668]
BIWB-1 Drug Info Discontinued in Phase 2 Melanoma [545821]
VLTS-587 Drug Info Discontinued in Phase 2 Lung cancer [546542]
Roquinimex Drug Info Discontinued in Phase 1 Rheumatoid arthritis [544912]
TG-1024 Drug Info Discontinued in Phase 1 Solid tumours [546632]
Modulator AIR-insulin Drug Info [528889]
Aldesleukin Drug Info [556264]
APN-301 Drug Info [550261]
Daclizumab Drug Info [889440]
Human interleukin-2 Drug Info [551913]
IL-2 antibody (anti-tumor), Hybritech Drug Info
IL-2 XL Drug Info [549990]
IL-2/gene-modified lymphocytes Drug Info [544272]
interleukin-2, Roussel Uclaf Drug Info
Leuvectin Drug Info [525794]
Medusa IL-2 Drug Info [1572591]
Roquinimex Drug Info [534129]
TG-1024 Drug Info [551644]
TG-1031 Drug Info
TG-2001 Drug Info
TG-4010 Drug Info [529572]
Thymoctonan Drug Info [534072]
VCL-1M01 Drug Info [533711]
VLTS-587 Drug Info [550853]
Agonist Nuleusin Drug Info [531915]
Inhibitor SP2456 Drug Info [551393]
SP4160 Drug Info [551393]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Allograft rejection
Graft-versus-host disease
NetPath Pathway IL-7 Signaling Pathway
TCR Signaling Pathway
TNFalpha Signaling Pathway
PANTHER Pathway Inflammation mediated by chemokine and cytokine signaling pathway
Interleukin signaling pathway
Pathway Interaction Database IL27-mediated signaling events
IL12-mediated signaling events
Calcineurin-regulated NFAT-dependent transcription in lymphocytes
SHP2 signaling
Regulation of Telomerase
Glucocorticoid receptor regulatory network
IL2-mediated signaling events
IL2 signaling events mediated by PI3K
AP-1 transcription factor network
IL23-mediated signaling events
IL2 signaling events mediated by STAT5
Calcium signaling in the CD4+ TCR pathway
Downstream signaling in na&amp
#xef
ve CD8+ T cells
IL12 signaling mediated by STAT4
Reactome GPVI-mediated activation cascade
gamma signalling through PI3Kgamma
Interleukin-2 signaling
RAF/MAP kinase cascade
Interleukin receptor SHC signaling
WikiPathways Cytokines and Inflammatory Response
IL-2 Signaling Pathway
Inflammatory Response Pathway
Aryl Hydrocarbon Receptor Pathway
Interleukin-2 signaling
T-Cell Receptor and Co-stimulatory Signaling
Spinal Cord Injury
Corticotropin-releasing hormone
Allograft Rejection
Arylhydrocarbon receptor (AhR) signaling pathway
Interleukin-3, 5 and GM-CSF signaling
Folate Metabolism
IL-5 Signaling Pathway
References
Ref 521442ClinicalTrials.gov (NCT00002435) A Study of Thymic Humoral Factor (THF Gamma 2) in HIV-Infected Patients. U.S. National Institutes of Health.
Ref 521459ClinicalTrials.gov (NCT00004050) Leuvectin Followed By Surgery in Treating Patients With Stage II or Stage III Prostate Cancer. U.S. National Institutes of Health.
Ref 521558ClinicalTrials.gov (NCT00062036) Cyclophosphamide and Fludarabine Followed By Interleukin-2 Gene-Modified Tumor Infiltrating Lymphocytes in Treating Patients With Metastatic Melanoma. U.S. National Institutes of Health.
Ref 521725ClinicalTrials.gov (NCT00223899) A Trial to Evaluate the Safety of Intratumoral VCL-IM01 Followed by Electroporation in Metastatic Melanoma. U.S. National Institutes of Health.
Ref 522201ClinicalTrials.gov (NCT00590824) Pilot hu14.18-IL2 in Resectable Recurrent Stage III or Stage IV Melanoma. U.S. National Institutes of Health.
Ref 523912ClinicalTrials.gov (NCT01604031) Treatment of B-CLL With Autologous IL2 and CD40 Ligand-Expressing Tumor Cells + Lenalidomide. U.S. National Institutes of Health.
Ref 529572A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 544912Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001478)
Ref 545821Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004906)
Ref 546542Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008879)
Ref 546632Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009282)
Ref 547897Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020218)
Ref 548240Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023655)
Ref 548544Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026492)
Ref 548668Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027551)
Ref 549990Pharmacokinetics (PK) and immunologic responses in a phase I/II study of a sustained release formulation of IL-2 in renal cell carcinoma (RCC) patients. J Clin Oncol (Meeting Abstracts) June 2006 vol. 24 no. 18_suppl 2558.
Ref 551015Clinical pipeline report, company report or official report of Immunservice GmbH.
Ref 551855Clinical pipeline report, company report or official report of Eli Lilly.
Ref 8894402016 FDA drug approvals. Nat Rev Drug Discov. 2017 Feb 2;16(2):73-76. doi: 10.1038/nrd.2017.14.
Ref
Ref 525794Intratumoral interleukin 2 for renal-cell carcinoma by direct gene transfer of a plasmid DNA/DMRIE/DOPE lipid complex. World J Urol. 2000 Apr;18(2):152-6.
Ref 527821Immunotherapy of high-risk acute leukemia with a recipient (autologous) vaccine expressing transgenic human CD40L and IL-2 after chemotherapy and allogeneic stem cell transplantation. Blood. 2006 Feb15;107(4):1332-41. Epub 2005 Oct 25.
Ref 528889The AIR inhaled insulin system: system components and pharmacokinetic/glucodynamic data. Diabetes Technol Ther. 2007 Jun;9 Suppl 1:S41-7.
Ref 529572A phase II study of Tg4010 (Mva-Muc1-Il2) in association with chemotherapy in patients with stage III/IV Non-small cell lung cancer. J Thorac Oncol. 2008 Jul;3(7):735-44.
Ref 530762BioPartnering North America--Programs from Pharma in Europe and the Middle East. IDrugs. 2010 Mar;13(3):162-5.
Ref 531915Expression, purification and characterization of recombinant human interleukin-2-serum albumin (rhIL-2-HSA) fusion protein in Pichia pastoris. Protein Expr Purif. 2012 Jul;84(1):154-60.
Ref 533711Interleukin-2 gene therapy in a patient with glioblastoma. Gene Ther. 1995 Mar;2(2):164-7.
Ref 534072Evaluation of efficacy and safety of thymus humoral factor-gamma 2 in the management of chronic hepatitis B. J Hepatol. 1995 Jul;23(1):21-7.
Ref 534129The novel immunomodulator, Linomide, stimulates interleukin-2-induced human natural killer (NK) cell and PHA-stimulated T cell proliferation from normal donors. Leuk Res. 1996 Jan;20(1):57-63.
Ref 544272Genetic modification of human T lymphocytes for the treatment of hematologic malignancies. Haematologica. 2012 November; 97(11): 1622-1631.
Ref 549990Pharmacokinetics (PK) and immunologic responses in a phase I/II study of a sustained release formulation of IL-2 in renal cell carcinoma (RCC) patients. J Clin Oncol (Meeting Abstracts) June 2006 vol. 24 no. 18_suppl 2558.
Ref 550172WO patent application no. 2013,1850,32, Nanotherapeutics for drug targeting.
Ref 550261Clinical pipeline report, company report or official report of APEIRON Biologics.
Ref 550452National Cancer Institute Drug Dictionary (drug id 665656).
Ref 550853CN patent application no. 101039956, Cell surface glycoprotein.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551644Melanoma and Immunotherapy. Hematology/Oncology Clinics of North America Volume 23, Issue 3, June 2009, Pages 547-564.
Ref 551913Clinical pipeline report, company report or official report of Immunservice.
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 8894402016 FDA drug approvals. Nat Rev Drug Discov. 2017 Feb 2;16(2):73-76. doi: 10.1038/nrd.2017.14.
Ref 1572591Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.