Target General Infomation
Target ID
T82277
Former ID
TTDNC00483
Target Name
NY-ESO-1
Gene Name
CTAG1A
Synonyms
Autoimmunogenic cancer/testis antigen NYESO1; CT6.1; CTAG1B; Cancer/testis antigen 1; Cancer/testis antigen 6.1; L antigen family member 2; LAGE2; CTAG1A
Target Type
Clinical Trial
Disease Cancer [ICD9: 140-229; ICD10: C00-C96]
Melanoma [ICD9: 172; ICD10: C43]
Non-small cell lung cancer [ICD10: C33-C34]
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
BioChemical Class
Transcription factor
UniProt ID
Sequence
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGA
PRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPG
VLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Drugs and Mode of Action
Drug(s) CDX-1401 Drug Info Phase 2 Solid tumours [524740]
CV-9201 Drug Info Phase 1/2 Non-small cell lung cancer [522696]
GSK-2241658A Drug Info Phase 1 Melanoma [523193]
NY-ESO-1 vaccine Drug Info Phase 1 Cancer [521703]
Melanoma vaccine Drug Info Discontinued in Phase 2 Melanoma [547218]
Modulator CDX-1401 Drug Info [550444]
References
Ref 521703ClinicalTrials.gov (NCT00199836) A Pilot Study of NY-ESO-1b Peptide Plus CpG 7909 and Montanide ISA-51 in Patients With Cancer.. U.S. National Institutes of Health.
Ref 522696ClinicalTrials.gov (NCT00923312) Trial of an RNActive-Derived Cancer Vaccine in Stage IIIB/IV Non Small Cell Lung Cancer (NSCLC). U.S. National Institutes of Health.
Ref 523193ClinicalTrials.gov (NCT01213472) Evaluation of a New Anti-cancer Immunotherapy in Patients With Non-operable and Progressing Metastatic Cutaneous Melanoma. U.S. National Institutes of Health.
Ref 524740ClinicalTrials.gov (NCT02129075) CDX-1401 and Poly-ICLC Vaccine Therapy With or Without CDX-301in Treating Patients With Stage IIB-IV Melanoma. U.S. National Institutes of Health.
Ref 547218Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014153)
Ref 523193ClinicalTrials.gov (NCT01213472) Evaluation of a New Anti-cancer Immunotherapy in Patients With Non-operable and Progressing Metastatic Cutaneous Melanoma. U.S. National Institutes of Health.
Ref 531162Preclinical qualification of a new multi-antigen candidate vaccine for metastatic melanoma. J Immunother. 2010 Oct;33(8):743-58.
Ref 544008Multiepitope CD8+ T cell response to a NY-ESO-1 peptide vaccine results in imprecise tumor targeting. J Clin Invest. 2002 December 15; 110(12): 1813-1822.
Ref 550441National Cancer Institute Drug Dictionary (drug id 648549).
Ref 550444National Cancer Institute Drug Dictionary (drug id 651880).