General Information of Drug-Metabolizing Enzyme (DME) (ID: DE3OALH)

DME Name Prostaglandin E synthase 2 (PTGES2)
Synonyms
Prostaglandin E synthase 2 truncated form; Prostaglandin-H(2) E-isomerase; mPGE synthase-2; Membrane-associated prostaglandin E synthase-2; Microsomal prostaglandin E synthase 2; PGES2; PTGES2; mPGES-2; C9orf15
Gene Name PTGES2
UniProt ID
PGES2_HUMAN
INTEDE ID
DME0589
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
80142
EC Number EC: 5.3.99.3
Isomerase
Intramolecular oxidoreductase
Intramolecular oxidoreductase
EC: 5.3.99.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL
DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQ
PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD
WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ
PWYLRVERAITEASPAH
Function This enzyme catalyzes the conversion of PGH2 into the more stable prostaglandin E2 (PGE2).
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of Prostaglandins (PG) and Thromboxanes (TX) (R-HSA-2162123 )
Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
DNCB DMDTVYC Immune System disease 4A01-4B41 Phase 2 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.81E-02 1.44E-01 5.76E-01
Alopecia ED70 Skin from scalp 4.62E-02 -1.35E-01 -5.09E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.35E-07 -1.99E-01 -8.11E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.41E-01 1.40E-01 8.59E-01
Aortic stenosis BB70 Calcified aortic valve 4.70E-01 8.28E-02 1.59E-01
Apnea 7A40 Hyperplastic tonsil 5.51E-01 -3.67E-02 -1.79E-01
Arthropathy FA00-FA5Z Peripheral blood 1.62E-01 -9.74E-02 -6.76E-01
Asthma CA23 Nasal and bronchial airway 4.71E-01 4.89E-02 1.76E-01
Atopic dermatitis EA80 Skin 6.01E-07 4.96E-01 1.20E+00
Autism 6A02 Whole blood 6.25E-03 -2.25E-01 -1.25E+00
Autoimmune uveitis 9A96 Peripheral monocyte 1.12E-02 -2.19E-01 -1.30E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.79E-01 4.37E-02 2.22E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.10E-04 2.34E-01 7.07E-01
Batten disease 5C56.1 Whole blood 6.16E-01 -1.26E-01 -6.79E-01
Behcet's disease 4A62 Peripheral blood 8.87E-01 -2.03E-02 -1.16E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.91E-02 -8.08E-02 -6.15E-01
Bladder cancer 2C94 Bladder tissue 2.26E-01 6.70E-02 2.92E-01
Breast cancer 2C60-2C6Z Breast tissue 2.98E-11 1.54E-01 4.61E-01
Cardioembolic stroke 8B11.20 Whole blood 2.54E-02 -1.19E-01 -6.60E-01
Cervical cancer 2C77 Cervical tissue 7.08E-01 -2.79E-02 -6.49E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.93E-02 7.26E-02 4.62E-01
Chronic hepatitis C 1E51.1 Whole blood 5.43E-01 -2.69E-02 -2.46E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.46E-01 -2.84E-02 -8.28E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.90E-03 1.06E-01 3.04E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.17E-01 1.18E-01 7.78E-01
Colon cancer 2B90 Colon tissue 1.28E-01 -9.85E-03 -3.43E-02
Coronary artery disease BA80-BA8Z Peripheral blood 4.36E-01 -7.31E-02 -4.27E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.10E-01 -2.00E-01 -7.00E-01
Endometriosis GA10 Endometrium tissue 6.34E-01 6.11E-02 1.46E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.19E-01 1.20E-01 7.93E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.93E-04 -2.37E-01 -1.03E+00
Gastric cancer 2B72 Gastric tissue 7.80E-01 -4.75E-02 -1.91E-01
Glioblastopma 2A00.00 Nervous tissue 2.62E-106 -6.75E-01 -1.56E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.25E-01 -2.18E-01 -4.84E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.99E-01 1.48E-01 3.69E-01
Head and neck cancer 2D42 Head and neck tissue 1.55E-03 1.01E-01 4.10E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.89E-01 -4.09E-02 -9.77E-02
Huntington's disease 8A01.10 Whole blood 3.12E-01 6.30E-02 3.78E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.81E-03 2.53E-01 2.97E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.02E-01 7.44E-02 8.96E-01
Influenza 1E30 Whole blood 3.37E-01 3.19E-01 1.79E+00
Interstitial cystitis GC00.3 Bladder tissue 5.95E-01 9.83E-02 4.91E-01
Intracranial aneurysm 8B01.0 Intracranial artery 7.01E-01 -6.22E-02 -1.07E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.83E-01 -1.03E-02 -5.48E-02
Ischemic stroke 8B11 Peripheral blood 6.56E-02 -8.98E-02 -7.70E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.96E-03 -1.21E-01 -4.56E-01
Lateral sclerosis 8B60.4 Skin 1.61E-01 2.44E-01 2.28E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.99E-01 -1.09E-01 -3.05E-01
Liver cancer 2C12.0 Liver tissue 4.99E-04 -7.72E-02 -3.85E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.06E-02 -3.42E-01 -1.32E+00
Lung cancer 2C25 Lung tissue 6.19E-19 2.25E-01 9.09E-01
Lupus erythematosus 4A40 Whole blood 2.51E-02 -8.27E-02 -1.99E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.40E-01 3.89E-02 2.91E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.47E-02 8.28E-02 4.48E-01
Melanoma 2C30 Skin 6.23E-01 8.00E-02 1.30E-01
Multiple myeloma 2A83.1 Peripheral blood 1.43E-01 -2.51E-01 -9.84E-01
Multiple myeloma 2A83.1 Bone marrow 2.61E-02 2.10E-01 7.44E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.59E-01 3.96E-02 3.50E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.24E-01 5.88E-02 1.83E-01
Myelofibrosis 2A20.2 Whole blood 1.77E-01 -5.48E-02 -4.43E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.30E-01 1.27E-02 4.51E-02
Myopathy 8C70.6 Muscle tissue 8.27E-03 -1.46E-01 -1.35E+00
Neonatal sepsis KA60 Whole blood 7.07E-02 -1.22E-01 -4.01E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.92E-07 -5.69E-01 -3.38E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.85E-01 -1.37E-01 -6.51E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.95E-01 2.82E-02 1.61E-01
Olive pollen allergy CA08.00 Peripheral blood 2.80E-03 5.28E-01 3.37E+00
Oral cancer 2B6E Oral tissue 5.89E-07 -4.61E-01 -1.37E+00
Osteoarthritis FA00-FA0Z Synovial tissue 4.15E-01 -4.52E-01 -1.52E+00
Osteoporosis FB83.1 Bone marrow 1.46E-02 2.55E-01 1.87E+00
Ovarian cancer 2C73 Ovarian tissue 3.39E-02 2.71E-01 8.17E-01
Pancreatic cancer 2C10 Pancreas 3.94E-01 -5.81E-02 -1.27E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.43E-01 -2.02E-01 -1.07E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.02E-01 8.01E-02 5.53E-01
Pituitary cancer 2D12 Pituitary tissue 2.96E-04 4.00E-01 2.04E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.01E-03 4.55E-01 2.60E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.40E-01 -6.02E-02 -2.37E-01
Polycythemia vera 2A20.4 Whole blood 8.46E-06 -1.17E-01 -9.02E-01
Pompe disease 5C51.3 Biceps muscle 2.32E-01 7.23E-02 3.26E-01
Preterm birth KA21.4Z Myometrium 7.01E-01 -7.10E-02 -4.00E-01
Prostate cancer 2C82 Prostate 7.71E-01 -1.13E-01 -1.91E-01
Psoriasis EA90 Skin 9.61E-02 3.82E-02 9.50E-02
Rectal cancer 2B92 Rectal colon tissue 6.96E-01 7.76E-02 1.17E+00
Renal cancer 2C90-2C91 Kidney 3.43E-03 -4.88E-01 -1.22E+00
Retinoblastoma 2D02.2 Uvea 2.88E-06 -4.73E-01 -2.65E+00
Rheumatoid arthritis FA20 Synovial tissue 1.04E-01 -4.87E-01 -8.97E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.98E-01 -5.20E-04 -3.51E-03
Schizophrenia 6A20 Prefrontal cortex 2.51E-03 -1.91E-01 -5.63E-01
Schizophrenia 6A20 Superior temporal cortex 2.07E-01 -5.40E-02 -3.50E-01
Scleroderma 4A42.Z Whole blood 2.73E-01 4.28E-02 3.40E-01
Seizure 8A60-8A6Z Whole blood 7.92E-01 -9.03E-02 -6.70E-01
Sensitive skin EK0Z Skin 3.61E-01 3.18E-02 1.78E-01
Sepsis with septic shock 1G41 Whole blood 6.06E-08 -1.93E-01 -6.98E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.28E-01 5.20E-02 4.10E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.35E-01 2.81E-01 5.86E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.57E-01 2.39E-02 1.66E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.27E-01 6.54E-03 2.04E-02
Skin cancer 2C30-2C3Z Skin 1.36E-02 1.22E-01 2.70E-01
Thrombocythemia 3B63 Whole blood 6.58E-07 -1.68E-01 -1.34E+00
Thrombocytopenia 3B64 Whole blood 5.12E-01 5.69E-01 5.31E-01
Thyroid cancer 2D10 Thyroid 2.35E-01 1.40E-02 4.66E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.22E-02 -2.62E-01 -7.69E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.10E-02 -3.59E-01 -2.37E+00
Type 2 diabetes 5A11 Liver tissue 2.43E-01 -3.08E-02 -1.82E-01
Ureter cancer 2C92 Urothelium 6.67E-01 -8.14E-02 -2.51E-01
Uterine cancer 2C78 Endometrium tissue 1.11E-04 -7.33E-02 -1.25E-01
Vitiligo ED63.0 Skin 4.72E-01 4.94E-02 2.36E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name HUMAN prostaglandin E synthase 2 (PTGES2) DTT Info

References

1 Human microsomal prostaglandin E synthase-1: purification, functional characterization, and projection structure determination. J Biol Chem. 2003 Jun 20;278(25):22199-209.