Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE5KEWZ)

DME Name Succinate-semialdehyde dehydrogenase (ALDH5A1)
Synonyms Aldehyde dehydrogenase family 5 member A1; NAD(+)-dependent succinic semialdehyde dehydrogenase; Mitochondrial succinate-semialdehyde dehydrogenase; ALDH5A1; SSADH
Gene Name ALDH5A1
UniProt ID
SSDH_HUMAN
INTEDE ID
DME0214
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7915
EC Number EC: 1.2.1.24
Oxidoreductase
Aldehyde/oxo donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.2.1.24
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKER
SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH
TPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV
KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAF
AEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFF
EPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWR
VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL
Function This enzyme catalyzes one step in the degradation of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA).
KEGG Pathway
Alanine, aspartate and glutamate metabolism (hsa00250 )
Butanoate metabolism (hsa00650 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Degradation of GABA (R-HSA-916853 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Sodium oxybate DMBOV5P Narcolepsy 7A20 Approved [4]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.03E-04 3.18E-01 6.31E-01
Alopecia ED70 Skin from scalp 5.29E-01 6.98E-02 2.99E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.01E-02 -5.52E-02 -1.73E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.31E-01 2.52E-01 5.97E-01
Aortic stenosis BB70 Calcified aortic valve 2.81E-01 -3.94E-01 -6.18E-01
Apnea 7A40 Hyperplastic tonsil 1.39E-01 3.02E-01 1.18E+00
Arthropathy FA00-FA5Z Peripheral blood 5.35E-01 6.60E-02 2.73E-01
Asthma CA23 Nasal and bronchial airway 3.79E-03 1.32E-01 3.32E-01
Atopic dermatitis EA80 Skin 8.97E-08 -4.72E-01 -2.05E+00
Autism 6A02 Whole blood 9.04E-01 -4.67E-02 -1.48E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.00E-01 4.96E-02 4.49E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.54E-01 -8.31E-02 -2.92E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.72E-01 7.50E-02 2.54E-01
Batten disease 5C56.1 Whole blood 3.45E-01 9.30E-03 3.98E-02
Behcet's disease 4A62 Peripheral blood 9.27E-01 6.42E-02 2.54E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.00E-01 7.91E-02 4.66E-01
Bladder cancer 2C94 Bladder tissue 1.27E-02 -6.09E-01 -1.30E+00
Breast cancer 2C60-2C6Z Breast tissue 3.14E-22 -3.46E-01 -7.89E-01
Cardioembolic stroke 8B11.20 Whole blood 8.64E-01 -7.53E-02 -1.35E-01
Cervical cancer 2C77 Cervical tissue 1.96E-03 -5.27E-01 -1.07E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.50E-01 7.42E-02 9.67E-02
Chronic hepatitis C 1E51.1 Whole blood 9.74E-01 -5.43E-02 -1.55E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.29E-01 -4.85E-02 -2.03E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.54E-01 -4.67E-02 -1.63E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.95E-03 -3.13E-01 -1.39E+00
Colon cancer 2B90 Colon tissue 2.70E-01 7.75E-02 2.32E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.69E-03 3.14E-01 2.90E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.70E-01 2.23E-01 4.58E-01
Endometriosis GA10 Endometrium tissue 1.06E-01 -3.31E-01 -5.37E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.35E-01 6.50E-02 5.93E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.30E-08 -1.28E+00 -2.01E+00
Gastric cancer 2B72 Gastric tissue 2.43E-01 3.20E-01 9.17E-01
Glioblastopma 2A00.00 Nervous tissue 8.00E-57 -7.38E-01 -1.29E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.68E-01 -2.58E-01 -7.46E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.84E-01 4.47E-01 5.48E-01
Head and neck cancer 2D42 Head and neck tissue 5.78E-17 -8.72E-01 -1.62E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.64E-01 -1.67E-01 -4.48E-01
Huntington's disease 8A01.10 Whole blood 9.01E-01 1.19E-01 3.00E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.01E-02 3.70E-01 2.12E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.00E-02 -2.61E-01 -1.54E+00
Influenza 1E30 Whole blood 1.53E-01 4.88E-02 3.14E-01
Interstitial cystitis GC00.3 Bladder tissue 5.44E-05 -1.40E+00 -5.69E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.19E-01 1.54E-01 3.92E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.63E-01 -4.87E-02 -2.83E-01
Ischemic stroke 8B11 Peripheral blood 9.74E-01 5.36E-02 1.50E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.51E-03 8.49E-02 3.35E-01
Lateral sclerosis 8B60.4 Skin 9.12E-01 4.38E-02 1.93E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.13E-02 3.73E-01 1.03E+00
Liver cancer 2C12.0 Liver tissue 4.72E-11 -4.85E-01 -1.31E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.88E-05 -2.35E+00 -8.65E+00
Lung cancer 2C25 Lung tissue 2.92E-01 -9.95E-02 -2.31E-01
Lupus erythematosus 4A40 Whole blood 1.53E-16 -4.82E-01 -8.03E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.42E-01 2.16E-02 1.40E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.72E-01 -4.15E-02 -1.50E-01
Melanoma 2C30 Skin 7.06E-01 -4.03E-01 -4.27E-01
Multiple myeloma 2A83.1 Peripheral blood 1.90E-01 -5.38E-02 -1.16E-01
Multiple myeloma 2A83.1 Bone marrow 2.72E-01 1.63E-01 4.85E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.98E-02 -5.37E-01 -1.71E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.77E-01 1.52E-01 3.27E-01
Myelofibrosis 2A20.2 Whole blood 9.38E-01 -1.30E-02 -3.80E-02
Myocardial infarction BA41-BA50 Peripheral blood 5.03E-02 -1.68E-01 -2.71E-01
Myopathy 8C70.6 Muscle tissue 4.27E-04 -5.44E-01 -2.37E+00
Neonatal sepsis KA60 Whole blood 2.60E-06 -5.10E-01 -1.18E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.93E-01 1.36E-01 3.44E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.26E-01 -1.14E-02 -2.90E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.37E-01 -2.16E-02 -5.55E-02
Olive pollen allergy CA08.00 Peripheral blood 9.06E-01 -1.47E-02 -2.60E-02
Oral cancer 2B6E Oral tissue 9.28E-01 9.72E-02 1.37E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.65E-01 -1.02E-01 -8.81E-02
Osteoporosis FB83.1 Bone marrow 5.36E-01 -1.48E-01 -5.12E-01
Ovarian cancer 2C73 Ovarian tissue 1.84E-02 3.99E-01 7.22E-01
Pancreatic cancer 2C10 Pancreas 2.50E-01 -2.66E-01 -4.43E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.07E-01 9.69E-02 4.23E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.62E-01 -7.50E-02 -3.34E-01
Pituitary cancer 2D12 Pituitary tissue 4.25E-03 4.35E-01 1.22E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.99E-04 7.27E-01 1.61E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.15E-01 -1.60E-01 -6.79E-01
Polycythemia vera 2A20.4 Whole blood 8.09E-01 2.37E-02 6.89E-02
Pompe disease 5C51.3 Biceps muscle 5.84E-06 -8.02E-01 -4.04E+00
Preterm birth KA21.4Z Myometrium 3.45E-01 1.77E-01 6.16E-01
Prostate cancer 2C82 Prostate 4.03E-02 2.09E-01 5.72E-01
Psoriasis EA90 Skin 4.63E-08 3.23E-01 8.38E-01
Rectal cancer 2B92 Rectal colon tissue 1.51E-01 -3.77E-01 -8.41E-01
Renal cancer 2C90-2C91 Kidney 1.43E-02 -2.62E-01 -7.38E-01
Retinoblastoma 2D02.2 Uvea 3.45E-02 -4.42E-01 -2.55E+00
Rheumatoid arthritis FA20 Synovial tissue 2.78E-02 -6.10E-01 -5.09E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.09E-01 -4.76E-02 -2.29E-01
Schizophrenia 6A20 Prefrontal cortex 1.16E-01 -7.42E-02 -1.12E-01
Schizophrenia 6A20 Superior temporal cortex 2.96E-01 9.04E-02 4.39E-01
Scleroderma 4A42.Z Whole blood 4.58E-03 -2.30E-01 -1.67E+00
Seizure 8A60-8A6Z Whole blood 2.67E-01 -1.97E-01 -2.93E-01
Sensitive skin EK0Z Skin 4.80E-01 5.60E-02 5.82E-01
Sepsis with septic shock 1G41 Whole blood 6.75E-34 -5.65E-01 -1.92E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.94E-01 -1.29E-02 -5.27E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.22E-01 9.22E-02 1.88E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.98E-02 -7.18E-02 -1.54E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.02E-01 2.21E-01 5.94E-01
Skin cancer 2C30-2C3Z Skin 2.43E-16 -3.25E-01 -8.10E-01
Thrombocythemia 3B63 Whole blood 1.37E-01 -1.84E-02 -5.31E-02
Thrombocytopenia 3B64 Whole blood 8.05E-02 -1.27E-01 -3.33E-01
Thyroid cancer 2D10 Thyroid 5.91E-03 -7.05E-03 -2.33E-02
Tibial muscular dystrophy 8C75 Muscle tissue 2.35E-06 -8.57E-01 -2.40E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.81E-01 1.71E-02 9.64E-02
Type 2 diabetes 5A11 Liver tissue 9.67E-01 -6.62E-02 -2.02E-01
Ureter cancer 2C92 Urothelium 6.47E-01 -5.42E-02 -3.28E-01
Uterine cancer 2C78 Endometrium tissue 6.95E-01 -4.08E-03 -6.78E-03
Vitiligo ED63.0 Skin 2.15E-01 -1.52E-01 -9.83E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Succinate-semialdehyde dehydrogenase (ALDH5A1) DTT Info
DME DTT Type Successful
2 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Chlormerodrin DMSF4PR Diagnostic imaging N.A. Approved [1]
Succinic acid DMDWICP Malnutrition 5B50-5B71 Approved [2]
1 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
T83193 DMHO29Y Discovery agent N.A. Patented [3]
1 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1-(4-hydroxyphenyl)prop-2-en-1-one DM145QS Discovery agent N.A. Investigative [3]

References

1 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
2 Redox-switch modulation of human SSADH by dynamic catalytic loop. EMBO J. 2009 Apr 8;28(7):959-68.
3 Inhibition of GABA shunt enzymes' activity by 4-hydroxybenzaldehyde derivatives. Bioorg Med Chem Lett. 2006 Feb;16(3):592-5.
4 Redox-switch modulation of human SSADH by dynamic catalytic loop. EMBO J. 2009 Apr 8;28(7):959-68.