Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE7OAB3)

DME Name N-acetyltransferase 1 (NAT1)
Synonyms Arylamine N-acetyltransferase 1; N-acetyltransferase type 1; Arylamide acetylase 1; Monomorphic arylamine N-acetyltransferase; MNAT; NAT-1; AAC1; NAT1
Gene Name NAT1
UniProt ID
ARY1_HUMAN
INTEDE ID
DME0050
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
9
EC Number EC: 2.3.1.5
Transferase
Acyltransferase
Acyltransferase
EC: 2.3.1.5
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVV
RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI
VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDL
LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT
HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
Function
This enzyme participates in the detoxification of a plethora of hydrazine and arylamine drugs. It catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
KEGG Pathway
Caffeine metabolism (hsa00232 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Acetylation (R-HSA-156582 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Amifampridine DMK08L3 LambertEaton myasthenic syndrome 8C62 Approved [1]
Hydralazine DMU8JGH Chronic heart failure BD1Z Approved [2]
Procainamide DMNMXR8 Ventricular arrhythmias BC71 Approved [3]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Asacolitin DM3WVPJ N. A. N. A. Investigative [4]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.46E-01 -5.34E-04 -1.01E-03
Alopecia ED70 Skin from scalp 3.47E-03 1.91E-01 5.42E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.10E-04 1.44E-01 6.35E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.96E-01 9.47E-02 3.50E-01
Aortic stenosis BB70 Calcified aortic valve 6.52E-01 1.50E-01 1.07E-01
Apnea 7A40 Hyperplastic tonsil 4.72E-01 4.89E-01 7.33E-01
Arthropathy FA00-FA5Z Peripheral blood 3.61E-01 1.94E-01 5.56E-01
Asthma CA23 Nasal and bronchial airway 3.78E-01 -4.32E-02 -5.78E-02
Atopic dermatitis EA80 Skin 2.33E-01 -2.70E-02 -9.72E-02
Autism 6A02 Whole blood 2.14E-01 4.05E-01 4.79E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.16E-01 4.45E-01 7.84E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.06E-01 4.98E-02 1.28E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.49E-09 -3.27E-01 -8.08E-01
Batten disease 5C56.1 Whole blood 3.15E-01 -3.95E-02 -1.65E-01
Behcet's disease 4A62 Peripheral blood 4.81E-01 2.28E-01 5.92E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.50E-01 -1.70E-03 -9.62E-03
Bladder cancer 2C94 Bladder tissue 2.19E-04 -1.17E+00 -2.87E+00
Breast cancer 2C60-2C6Z Breast tissue 1.77E-56 1.54E+00 1.36E+00
Cardioembolic stroke 8B11.20 Whole blood 2.03E-04 4.99E-01 1.14E+00
Cervical cancer 2C77 Cervical tissue 1.89E-01 9.42E-02 2.54E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.19E-01 9.39E-02 1.57E-01
Chronic hepatitis C 1E51.1 Whole blood 1.23E-01 1.18E-01 4.30E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.98E-01 -8.89E-02 -2.36E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.88E-02 7.81E-02 2.26E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.95E-01 -1.18E+00 -1.12E+00
Colon cancer 2B90 Colon tissue 4.68E-107 -1.56E+00 -3.37E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.02E-01 5.94E-01 5.35E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.62E-01 2.24E-01 4.97E-01
Endometriosis GA10 Endometrium tissue 1.09E-01 -4.86E-01 -9.43E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.98E-01 2.21E-01 6.71E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.12E-13 1.25E+00 1.56E+00
Gastric cancer 2B72 Gastric tissue 4.77E-01 5.40E-01 2.05E-01
Glioblastopma 2A00.00 Nervous tissue 2.56E-100 9.67E-01 1.55E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.79E-01 -8.45E-01 -1.65E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.22E-01 5.07E-02 4.55E-02
Head and neck cancer 2D42 Head and neck tissue 1.63E-16 -8.87E-01 -5.52E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.71E-01 -3.08E-02 -1.17E-01
Huntington's disease 8A01.10 Whole blood 3.81E-01 -3.20E-01 -5.94E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.01E-01 9.65E-01 1.54E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.00E-05 3.25E-01 2.19E+00
Influenza 1E30 Whole blood 1.55E-02 -1.13E+00 -6.52E+00
Interstitial cystitis GC00.3 Bladder tissue 1.99E-01 2.04E-01 1.04E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.09E-06 1.08E+00 1.65E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.59E-01 -2.99E-02 -1.27E-01
Ischemic stroke 8B11 Peripheral blood 1.37E-01 -1.09E-01 -2.27E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.78E-01 -1.11E-01 -2.30E-01
Lateral sclerosis 8B60.4 Skin 6.13E-01 4.79E-02 2.13E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.27E-02 2.56E-01 1.36E+00
Liver cancer 2C12.0 Liver tissue 2.08E-19 -1.02E+00 -2.03E+00
Liver failure DB99.7-DB99.8 Liver tissue 6.79E-05 -9.04E-01 -2.63E+00
Lung cancer 2C25 Lung tissue 8.04E-01 8.27E-02 1.48E-01
Lupus erythematosus 4A40 Whole blood 1.09E-14 5.21E-01 9.95E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.50E-01 -3.03E-02 -1.62E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.21E-01 -3.82E-02 -6.65E-02
Melanoma 2C30 Skin 5.01E-01 4.64E-01 4.69E-01
Multiple myeloma 2A83.1 Peripheral blood 8.63E-01 1.50E-01 3.67E-01
Multiple myeloma 2A83.1 Bone marrow 1.31E-04 4.15E-01 1.83E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.66E-01 -1.43E-01 -3.74E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.45E-03 3.35E-01 5.65E-01
Myelofibrosis 2A20.2 Whole blood 3.17E-02 5.11E-01 1.12E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.53E-01 4.43E-01 3.15E-01
Myopathy 8C70.6 Muscle tissue 4.12E-07 1.07E+00 3.88E+00
Neonatal sepsis KA60 Whole blood 1.54E-14 7.08E-01 1.21E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.73E-05 5.22E-01 1.38E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.69E-01 -3.63E-01 -1.02E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.49E-01 9.67E-02 2.41E-01
Olive pollen allergy CA08.00 Peripheral blood 8.58E-01 -8.22E-02 -9.99E-02
Oral cancer 2B6E Oral tissue 1.33E-03 7.83E-01 6.32E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.12E-02 5.64E-01 6.03E-01
Osteoporosis FB83.1 Bone marrow 2.06E-01 -3.87E-01 -2.18E+00
Ovarian cancer 2C73 Ovarian tissue 9.09E-03 5.99E-01 7.73E-01
Pancreatic cancer 2C10 Pancreas 3.65E-03 3.99E-01 4.50E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.42E-01 8.14E-02 3.19E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.99E-04 5.02E-01 1.53E+00
Pituitary cancer 2D12 Pituitary tissue 2.90E-01 4.28E-01 9.82E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.11E-02 9.68E-01 2.70E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.64E-02 -5.86E-02 -2.43E-01
Polycythemia vera 2A20.4 Whole blood 1.16E-01 1.11E-01 2.40E-01
Pompe disease 5C51.3 Biceps muscle 4.11E-02 2.35E-01 1.28E+00
Preterm birth KA21.4Z Myometrium 7.28E-01 3.33E-03 4.76E-03
Prostate cancer 2C82 Prostate 3.21E-03 -6.53E-01 -5.55E-01
Psoriasis EA90 Skin 1.17E-06 2.81E-01 4.42E-01
Rectal cancer 2B92 Rectal colon tissue 2.34E-05 -1.27E+00 -3.66E+00
Renal cancer 2C90-2C91 Kidney 6.02E-01 2.56E-02 4.91E-02
Retinoblastoma 2D02.2 Uvea 2.23E-09 2.66E+00 5.30E+00
Rheumatoid arthritis FA20 Synovial tissue 7.80E-02 5.37E-01 6.62E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.24E-01 -5.46E-02 -1.62E-01
Schizophrenia 6A20 Prefrontal cortex 2.05E-01 8.49E-03 4.69E-03
Schizophrenia 6A20 Superior temporal cortex 6.09E-01 -2.44E-03 -1.95E-02
Scleroderma 4A42.Z Whole blood 2.05E-03 5.58E-01 2.01E+00
Seizure 8A60-8A6Z Whole blood 9.01E-02 7.19E-01 1.55E+00
Sensitive skin EK0Z Skin 8.38E-01 1.33E-01 6.82E-01
Sepsis with septic shock 1G41 Whole blood 1.59E-17 4.61E-01 8.17E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.56E-01 2.58E-01 3.06E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.05E-02 -7.41E-01 -1.10E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 8.88E-02 -4.23E-01 -1.23E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.26E-01 3.21E-01 6.76E-01
Skin cancer 2C30-2C3Z Skin 1.43E-02 2.32E-01 4.19E-01
Thrombocythemia 3B63 Whole blood 6.41E-01 5.35E-02 1.16E-01
Thrombocytopenia 3B64 Whole blood 5.53E-01 -7.53E-01 -6.42E-01
Thyroid cancer 2D10 Thyroid 4.82E-02 4.06E-02 9.61E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.28E-07 8.36E-01 4.79E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.13E-02 7.16E-01 4.47E+00
Type 2 diabetes 5A11 Liver tissue 9.99E-01 -2.39E-01 -5.19E-01
Ureter cancer 2C92 Urothelium 2.34E-02 -4.02E-01 -1.01E+00
Uterine cancer 2C78 Endometrium tissue 3.86E-03 2.38E-01 3.16E-01
Vitiligo ED63.0 Skin 2.54E-01 -1.70E-01 -5.82E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Genetic variation in aryl N-acetyltransferase results in significant differences in the pharmacokinetic and safety profiles of amifampridine (3,4-diaminopyridine) phosphate. Pharmacol Res Perspect. 2015 Feb;3(1):e00099.
2 N-acetyltransferase 2 genotype-dependent N-acetylation of hydralazine in human hepatocytes. Drug Metab Dispos. 2017 Dec;45(12):1276-1281.
3 Longitudinal distribution of arylamine N-acetyltransferases in the intestine of the hamster, mouse, and rat. Evidence for multiplicity of N-acetyltransferases in the intestine. Biochem Pharmacol. 1996 Nov 22;52(10):1613-20.
4 Identification and functional characterization of arylamine N-acetyltransferases in eubacteria: evidence for highly selective acetylation of 5-aminosalicylic acid. J Bacteriol. 2001 Jun;183(11):3417-27.