Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE7P2FB)

DME Name Aldo-keto reductase 1C1 (AKR1C1)
Synonyms
Aldo-keto reductase family 1 member C1; Chlordecone reductase homolog HAKRC; DD1/DD2; DDH; DDH1; Dihydrodiol dehydrogenase 1/2; HBAB; High-affinity hepatic bile acid-binding protein; Indanol dehydrogenase; Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; 20-alpha-hydroxysteroid dehydrogenase; AKR1C1
Gene Name AKR1C1
UniProt ID
AK1C1_HUMAN
INTEDE ID
DME0197
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1645
EC Number EC: 1.1.1.149
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.149
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
Function This enzyme converts progesterone to its inactive form, 20-alpha- dihydroxyprogesterone (20-alpha-OHP).
KEGG Pathway
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Synthesis of bile acids and bile salts via 24-hydroxycholesterol (R-HSA-193775 )
Synthesis of bile acids and bile salts via 27-hydroxycholesterol (R-HSA-193807 )
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (R-HSA-193368 )
Retinoid metabolism and transport (R-HSA-975634 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
4 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
FENOFIBRIC ACID DMGO2MC Cardiovascular disease BA00-BE2Z Approved [1]
Nabumetone DMAT2XH Osteoarthritis FA00-FA05 Approved [2]
Progesterone DMUY35B Amenorrhea GA20.0 Approved [3]
Dihydrotestosterone DM3S8XC Prostate hyperplasia GA90 Phase 4 [3]
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Trastuzumab emtansine DMU1LXS HER2-positive breast cancer 2C60-2C65 Phase 2 [4]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
BRN-3548355 DM4KXT0 N. A. N. A. Investigative [5]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Dihydrotestosterone Prostate hyperplasia [GA90] Phase 4 Km = 0.00218 microM [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.56E-13 -2.79E-01 -1.03E+00
Alopecia ED70 Skin from scalp 4.02E-01 2.05E-02 5.45E-02
Alzheimer's disease 8A20 Entorhinal cortex 7.03E-02 6.23E-02 2.87E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.99E-01 7.09E-02 2.96E-01
Aortic stenosis BB70 Calcified aortic valve 4.19E-01 -1.86E-01 -3.31E-01
Apnea 7A40 Hyperplastic tonsil 7.35E-03 -1.26E+00 -2.29E+00
Arthropathy FA00-FA5Z Peripheral blood 9.64E-01 -1.78E-03 -1.08E-02
Asthma CA23 Nasal and bronchial airway 9.66E-03 -8.27E-02 -1.41E-01
Atopic dermatitis EA80 Skin 5.53E-01 -2.48E-02 -9.21E-02
Autism 6A02 Whole blood 2.57E-02 -1.61E-01 -7.31E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.11E-02 -2.93E-01 -2.73E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.46E-01 3.46E-02 2.17E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.02E-07 -2.95E-01 -9.52E-01
Batten disease 5C56.1 Whole blood 1.60E-01 -1.70E-01 -1.05E+00
Behcet's disease 4A62 Peripheral blood 4.57E-01 5.25E-02 3.10E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.87E-01 -2.29E-02 -1.30E-01
Bladder cancer 2C94 Bladder tissue 8.40E-05 -5.49E-01 -2.26E+00
Breast cancer 2C60-2C6Z Breast tissue 4.48E-90 -1.82E+00 -2.15E+00
Cardioembolic stroke 8B11.20 Whole blood 3.74E-01 -1.25E-01 -5.84E-01
Cervical cancer 2C77 Cervical tissue 3.66E-01 6.57E-02 1.48E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.70E-02 1.73E-02 8.41E-02
Chronic hepatitis C 1E51.1 Whole blood 1.87E-01 1.36E-01 9.35E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.21E-01 -3.47E-02 -1.53E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.16E-07 5.19E-01 9.48E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.35E-01 -5.07E-01 -9.57E-01
Colon cancer 2B90 Colon tissue 1.25E-49 -5.25E-01 -1.76E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.34E-01 1.01E-01 8.65E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.50E-01 -7.91E-02 -3.62E-01
Endometriosis GA10 Endometrium tissue 8.18E-01 4.60E-02 8.49E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.21E-01 -4.02E-02 -3.25E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.03E-05 -2.57E-01 -1.16E+00
Gastric cancer 2B72 Gastric tissue 9.58E-02 -9.24E-01 -1.94E+00
Glioblastopma 2A00.00 Nervous tissue 3.54E-25 -2.55E-01 -8.35E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.02E-01 -4.83E-01 -1.16E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.87E-01 9.10E-01 1.07E+00
Head and neck cancer 2D42 Head and neck tissue 7.49E-01 -1.13E-01 -1.89E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.50E-02 -2.14E-01 -7.87E-01
Huntington's disease 8A01.10 Whole blood 9.68E-03 1.77E-01 1.27E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.81E-01 -4.38E-01 -1.23E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.20E-01 7.95E-02 5.59E-01
Influenza 1E30 Whole blood 3.36E-01 -2.97E-01 -7.47E-01
Interstitial cystitis GC00.3 Bladder tissue 1.79E-05 -1.02E+00 -5.01E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.75E-02 -2.11E-02 -8.42E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.34E-02 -1.44E-01 -6.73E-01
Ischemic stroke 8B11 Peripheral blood 7.64E-01 -2.40E-03 -1.50E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.90E-01 -3.61E-02 -1.38E-01
Lateral sclerosis 8B60.4 Skin 8.62E-02 3.85E-01 1.14E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 7.62E-01 5.32E-02 1.24E-01
Liver cancer 2C12.0 Liver tissue 6.53E-01 1.87E-01 5.44E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.23E-01 -2.88E-02 -5.76E-02
Lung cancer 2C25 Lung tissue 1.68E-11 -4.42E-02 -1.66E-01
Lupus erythematosus 4A40 Whole blood 4.78E-01 4.64E-03 1.27E-02
Major depressive disorder 6A70-6A7Z Hippocampus 4.07E-01 1.00E-02 5.62E-02
Major depressive disorder 6A70-6A7Z Whole blood 7.29E-01 -3.02E-02 -1.18E-01
Melanoma 2C30 Skin 6.29E-06 -8.98E-01 -1.30E+00
Multiple myeloma 2A83.1 Peripheral blood 6.74E-01 2.93E-02 1.11E-01
Multiple myeloma 2A83.1 Bone marrow 1.19E-03 -3.07E-01 -1.96E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.12E-01 -2.99E-02 -1.21E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.42E-01 9.22E-02 4.95E-01
Myelofibrosis 2A20.2 Whole blood 3.10E-03 9.07E-02 7.02E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.26E-01 4.13E-02 1.09E-01
Myopathy 8C70.6 Muscle tissue 8.49E-02 3.97E-01 9.08E-01
Neonatal sepsis KA60 Whole blood 6.28E-01 2.79E-02 1.11E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.76E-12 -1.14E+00 -6.08E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.13E-01 1.68E-01 4.25E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.49E-01 7.49E-01 1.05E+00
Olive pollen allergy CA08.00 Peripheral blood 4.53E-01 -1.50E-01 -2.71E-01
Oral cancer 2B6E Oral tissue 8.65E-01 -1.24E-01 -1.80E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.60E-01 -2.63E-01 -8.39E-01
Osteoporosis FB83.1 Bone marrow 5.33E-02 -4.47E-01 -1.15E+00
Ovarian cancer 2C73 Ovarian tissue 1.39E-03 -5.49E-01 -2.12E+00
Pancreatic cancer 2C10 Pancreas 8.55E-01 4.18E-02 5.95E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 1.16E-03 4.27E-01 3.54E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.04E-01 -4.17E-02 -3.33E-01
Pituitary cancer 2D12 Pituitary tissue 3.69E-03 -5.94E-01 -1.57E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.35E-04 -8.52E-01 -2.09E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.27E-01 1.73E-02 4.28E-02
Polycythemia vera 2A20.4 Whole blood 4.71E-03 1.04E-01 7.81E-01
Pompe disease 5C51.3 Biceps muscle 1.61E-06 7.49E-01 2.94E+00
Preterm birth KA21.4Z Myometrium 9.64E-01 -7.03E-02 -4.83E-01
Prostate cancer 2C82 Prostate 3.79E-01 -6.65E-02 -9.95E-02
Psoriasis EA90 Skin 2.65E-04 1.07E-01 3.97E-01
Rectal cancer 2B92 Rectal colon tissue 5.13E-04 -4.45E-01 -2.50E+00
Renal cancer 2C90-2C91 Kidney 3.90E-01 -2.54E-01 -3.99E-01
Retinoblastoma 2D02.2 Uvea 1.85E-12 -1.63E+00 -8.49E+00
Rheumatoid arthritis FA20 Synovial tissue 5.75E-03 3.11E-01 1.19E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.08E-01 -3.98E-02 -1.46E-01
Schizophrenia 6A20 Prefrontal cortex 1.05E-01 -6.04E-02 -1.75E-01
Schizophrenia 6A20 Superior temporal cortex 2.15E-01 -5.14E-02 -3.95E-01
Scleroderma 4A42.Z Whole blood 6.10E-02 1.41E-01 1.17E+00
Seizure 8A60-8A6Z Whole blood 3.49E-01 1.16E-01 6.39E-01
Sensitive skin EK0Z Skin 9.14E-01 5.10E-02 2.50E-01
Sepsis with septic shock 1G41 Whole blood 8.80E-07 8.38E-02 3.11E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.82E-02 3.57E-01 1.59E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.96E-01 6.09E-02 2.90E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.11E-01 3.17E-03 1.78E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.54E-01 6.29E-02 2.93E+00
Skin cancer 2C30-2C3Z Skin 2.48E-80 -1.12E+00 -2.91E+00
Thrombocythemia 3B63 Whole blood 2.49E-01 5.84E-02 4.94E-01
Thrombocytopenia 3B64 Whole blood 4.70E-01 1.39E+00 1.06E+00
Thyroid cancer 2D10 Thyroid 5.70E-32 -6.83E-01 -2.74E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.85E-02 -3.00E-01 -7.48E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.11E-01 3.04E-01 2.77E+00
Type 2 diabetes 5A11 Liver tissue 5.64E-01 -7.28E-02 -3.40E-01
Ureter cancer 2C92 Urothelium 3.39E-02 1.88E-01 6.02E-01
Uterine cancer 2C78 Endometrium tissue 2.01E-05 2.14E-01 3.73E-01
Vitiligo ED63.0 Skin 3.00E-01 -6.67E-02 -3.98E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 In vitro metabolism of fenofibric acid by carbonyl reducing enzymes. Chem Biol Interact. 2016 Oct 25;258:153-8.
2 Reductive metabolism of nabumetone by human liver microsomal and cytosolic fractions: exploratory prediction using inhibitors and substrates as marker probes. Eur J Drug Metab Pharmacokinet. 2015 Jun;40(2):127-35.
3 Human 3-alpha hydroxysteroid dehydrogenase type 3 (3alpha-HSD3): the V54L mutation restricting the steroid alternative binding and enhancing the 20alpha-HSD activity. J Steroid Biochem Mol Biol. 2014 May;141:135-43.
4 The role of carbonyl reducing enzymes in oxcarbazepine in vitro metabolism in man. Chem Biol Interact. 2014 Sep 5;220:241-7.
5 Characterization of enzymes participating in carbonyl reduction of 4-methylnitrosamino-1-(3-pyridyl)-1-butanone (NNK) in human placenta. Chem Biol Interact. 2001 Jan 30;130-132(1-3):737-48.