Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEA0BDX)

DME Name Matrix metalloproteinase-9 (MMP-9)
Synonyms Gelatinase B; 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG4B; GELB; MMP-9; MMP9
Gene Name MMP9
UniProt ID
MMP9_HUMAN
INTEDE ID
DME0564
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4318
EC Number EC: 3.4.24.35
Hydrolases
Peptidase
Metallopeptidase
EC: 3.4.24.35
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Function
This enzyme cleaves KiSS1 at a Gly-|-Leu bond and cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments.It also degrades fibronectin but not laminin or Pz-peptide.
KEGG Pathway
Bladder cancer (hsa05219 )
Endocrine resistance (hsa01522 )
Estrogen signaling pathway (hsa04915 )
Fluid shear stress and atherosclerosis (hsa05418 )
Hepatitis B (hsa05161 )
IL-17 signaling pathway (hsa04657 )
Leukocyte transendothelial migration (hsa04670 )
MicroRNAs in cancer (hsa05206 )
Pathways in cancer (hsa05200 )
Prostate cancer (hsa05215 )
Proteoglycans in cancer (hsa05205 )
Relaxin signaling pathway (hsa04926 )
TNF signaling pathway (hsa04668 )
Transcriptional misregulation in cancer (hsa05202 )
Reactome Pathway
Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090 )
Collagen degradation (R-HSA-1442490 )
Degradation of the extracellular matrix (R-HSA-1474228 )
EPH-ephrin mediated repulsion of cells (R-HSA-3928665 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )
Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
Neutrophil degranulation (R-HSA-6798695 )
Signaling by SCF-KIT (R-HSA-1433557 )
Activation of Matrix Metalloproteinases (R-HSA-1592389 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Amylin DMWDEN0 N. A. N. A. Phase 4 [37]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.07E-130 -4.78E+00 -6.90E+00
Alopecia ED70 Skin from scalp 3.65E-06 5.92E-01 9.84E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.71E-02 1.40E-02 5.50E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 6.40E-01 -3.65E-02 -1.28E-01
Aortic stenosis BB70 Calcified aortic valve 1.11E-03 2.56E+00 2.52E+00
Apnea 7A40 Hyperplastic tonsil 3.03E-01 9.79E-01 1.55E+00
Arthropathy FA00-FA5Z Peripheral blood 4.07E-02 6.62E-01 1.03E+00
Asthma CA23 Nasal and bronchial airway 2.56E-02 2.54E-01 3.04E-01
Atopic dermatitis EA80 Skin 2.38E-03 5.42E-01 1.10E+00
Autism 6A02 Whole blood 1.55E-01 6.59E-01 7.15E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.82E-02 1.10E+00 2.40E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.59E-05 1.21E+00 2.72E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.93E-13 1.10E+00 1.38E+00
Batten disease 5C56.1 Whole blood 3.87E-01 -3.54E-02 -1.12E-01
Behcet's disease 4A62 Peripheral blood 8.37E-02 4.50E-02 1.68E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.48E-01 -3.55E-02 -1.96E-01
Bladder cancer 2C94 Bladder tissue 4.06E-04 9.93E-01 1.56E+00
Breast cancer 2C60-2C6Z Breast tissue 1.35E-110 2.48E+00 2.34E+00
Cardioembolic stroke 8B11.20 Whole blood 4.55E-06 1.27E+00 1.49E+00
Cervical cancer 2C77 Cervical tissue 2.38E-07 1.53E+00 2.01E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.78E-01 1.50E-01 5.88E-02
Chronic hepatitis C 1E51.1 Whole blood 5.76E-01 2.86E-01 3.84E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.98E-01 2.35E-01 2.44E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.86E-03 2.54E-01 4.78E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.43E-01 2.18E-01 1.26E-01
Colon cancer 2B90 Colon tissue 8.50E-26 9.32E-01 1.11E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.99E-01 -6.54E-01 -2.89E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.15E-01 7.44E-02 5.99E-01
Endometriosis GA10 Endometrium tissue 5.47E-02 1.42E-01 3.32E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.97E-01 -7.87E-02 -2.00E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.61E-13 -2.62E+00 -1.86E+00
Gastric cancer 2B72 Gastric tissue 1.28E-01 2.10E+00 1.75E+00
Glioblastopma 2A00.00 Nervous tissue 1.63E-89 5.14E-01 1.38E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.90E-01 2.71E-01 8.96E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.06E-03 3.12E+00 1.64E+00
Head and neck cancer 2D42 Head and neck tissue 1.39E-39 3.92E+00 2.72E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.28E-01 -7.01E-02 -4.84E-01
Huntington's disease 8A01.10 Whole blood 5.68E-01 8.94E-03 2.52E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.09E-01 -1.33E+00 -1.18E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.80E-01 2.11E-02 1.81E-01
Influenza 1E30 Whole blood 5.19E-01 -3.67E-01 -2.32E-01
Interstitial cystitis GC00.3 Bladder tissue 1.55E-04 2.67E+00 3.24E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.26E-01 9.57E-01 1.37E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.31E-01 1.01E-01 1.08E-01
Ischemic stroke 8B11 Peripheral blood 1.61E-01 8.19E-01 9.40E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.83E-02 2.21E-01 1.14E-01
Lateral sclerosis 8B60.4 Skin 5.17E-01 3.35E-02 1.09E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.52E-01 1.47E-01 4.86E-01
Liver cancer 2C12.0 Liver tissue 4.42E-11 7.21E-01 1.11E+00
Liver failure DB99.7-DB99.8 Liver tissue 5.48E-01 1.33E-01 1.76E-01
Lung cancer 2C25 Lung tissue 3.53E-54 2.03E+00 1.94E+00
Lupus erythematosus 4A40 Whole blood 6.72E-07 8.25E-01 6.08E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.82E-01 2.19E-02 1.13E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.08E-02 2.05E-01 2.61E-01
Melanoma 2C30 Skin 1.81E-11 2.06E+00 2.28E+00
Multiple myeloma 2A83.1 Peripheral blood 8.05E-01 -3.29E-02 -6.98E-02
Multiple myeloma 2A83.1 Bone marrow 8.49E-01 -2.66E-01 -6.04E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.66E-01 4.93E-02 1.72E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.69E-01 9.40E-02 7.11E-02
Myelofibrosis 2A20.2 Whole blood 2.04E-02 8.69E-01 1.54E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.09E-08 2.20E+00 1.36E+00
Myopathy 8C70.6 Muscle tissue 2.08E-04 6.21E-01 2.98E+00
Neonatal sepsis KA60 Whole blood 1.99E-29 3.75E+00 2.38E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.24E-06 6.91E-01 1.70E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.41E-02 8.42E-01 2.80E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.81E-01 5.07E-01 9.41E-01
Olive pollen allergy CA08.00 Peripheral blood 7.24E-01 -1.26E-01 -3.43E-01
Oral cancer 2B6E Oral tissue 2.70E-14 2.66E+00 2.66E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.59E-01 1.10E-01 2.51E-01
Osteoporosis FB83.1 Bone marrow 2.38E-01 7.11E-02 2.32E-01
Ovarian cancer 2C73 Ovarian tissue 1.15E-07 1.57E+00 3.98E+00
Pancreatic cancer 2C10 Pancreas 4.08E-02 1.67E+00 9.13E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.76E-01 -5.03E-02 -2.04E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.18E-05 2.72E+00 1.31E+01
Pituitary cancer 2D12 Pituitary tissue 1.50E-01 1.47E-01 4.28E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.99E-01 3.18E-03 1.42E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.75E-02 1.00E-01 4.59E-01
Polycythemia vera 2A20.4 Whole blood 5.46E-07 7.74E-01 1.36E+00
Pompe disease 5C51.3 Biceps muscle 1.70E-01 -1.70E-01 -3.24E-01
Preterm birth KA21.4Z Myometrium 2.42E-01 -1.11E+00 -7.01E-01
Prostate cancer 2C82 Prostate 6.62E-01 5.13E-02 4.24E-02
Psoriasis EA90 Skin 3.44E-06 3.80E-01 5.13E-01
Rectal cancer 2B92 Rectal colon tissue 3.90E-02 8.37E-01 1.23E+00
Renal cancer 2C90-2C91 Kidney 1.12E-10 1.15E+00 3.45E+00
Retinoblastoma 2D02.2 Uvea 2.46E-01 -2.93E-01 -1.13E+00
Rheumatoid arthritis FA20 Synovial tissue 7.66E-05 8.06E-01 1.83E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.46E-02 3.27E-01 5.92E-01
Schizophrenia 6A20 Prefrontal cortex 1.02E-03 1.36E-01 4.31E-01
Schizophrenia 6A20 Superior temporal cortex 2.30E-01 4.67E-02 2.11E-01
Scleroderma 4A42.Z Whole blood 1.88E-01 5.27E-01 8.35E-01
Seizure 8A60-8A6Z Whole blood 2.57E-01 8.99E-01 7.88E-01
Sensitive skin EK0Z Skin 9.24E-01 5.93E-03 1.43E-02
Sepsis with septic shock 1G41 Whole blood 1.94E-77 4.22E+00 2.89E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.30E-01 -2.54E-01 -4.47E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.68E-01 2.48E-02 1.48E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.33E-01 -4.33E-02 -6.17E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.72E-01 -7.01E-03 -8.77E-03
Skin cancer 2C30-2C3Z Skin 3.97E-37 1.43E+00 1.91E+00
Thrombocythemia 3B63 Whole blood 3.20E-01 2.40E-01 4.25E-01
Thrombocytopenia 3B64 Whole blood 2.27E-02 1.49E+00 1.15E+00
Thyroid cancer 2D10 Thyroid 1.19E-09 1.99E+00 1.11E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.67E-01 -2.32E-03 -7.21E-03
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.28E-02 -3.57E-01 -2.43E+00
Type 2 diabetes 5A11 Liver tissue 8.81E-01 4.58E-02 1.18E-01
Ureter cancer 2C92 Urothelium 2.77E-01 1.20E-01 1.88E-01
Uterine cancer 2C78 Endometrium tissue 1.76E-20 1.79E+00 1.34E+00
Vitiligo ED63.0 Skin 7.30E-01 -6.10E-02 -9.73E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Matrix metalloproteinase-9 (MMP-9) DTT Info
DME DTT Type Clinical trial
6 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Andecaliximab DMLDB1X Gastric adenocarcinoma 2B72 Phase 3 [1]
Curcumin DMQPH29 Solid tumour/cancer 2A00-2F9Z Phase 3 [2]
DP-b99 DM97S10 Stroke 8B20 Phase 3 [3]
GS-5745 DMP8MDW Gastric adenocarcinoma 2B72 Phase 3 [4]
BLZ-100 DMFKA4G Glioma 2A00.0 Phase 1/2 [5]
Neovastat DMXTYWJ Non-small-cell lung cancer 2C25.Y Phase 1 [6]
⏷ Show the Full List of 6 Clinical Trial Drug(s)
8 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PMID29130358-Compound-Figure13(4) DMDFPIO N. A. N. A. Patented [7]
PMID29130358-Compound-Figure17(10) DMVA15O N. A. N. A. Patented [7]
PMID29130358-Compound-Figure17(11) DMSZA9L N. A. N. A. Patented [7]
PMID29130358-Compound-Figure17(12) DMML4PA N. A. N. A. Patented [7]
PMID29130358-Compound-Figure17(13) DM2QRIW N. A. N. A. Patented [7]
PMID29130358-Compound-Figure18(14a) DMHIBTZ N. A. N. A. Patented [7]
PMID29130358-Compound-LonimacranthoideVII DMOGIAU N. A. N. A. Patented [7]
PMID29130358-Compound-SB-3CT DMC64XQ N. A. N. A. Patented [7]
⏷ Show the Full List of 8 Patented Agent(s)
7 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Galarubicin DMTNYSF Solid tumour/cancer 2A00-2F9Z Discontinued in Phase 2 [8]
GM6001 DM7V9CT Corneal ulcer 9A76 Discontinued in Phase 2 [9]
RS-130830 DMOTANY Hepatitis C virus infection 1E51.1 Discontinued in Phase 2 [10]
CDP-845 DMGMS2D Solid tumour/cancer 2A00-2F9Z Terminated [12]
CT-1746 DM84KOY Colorectal cancer 2B91.Z Terminated [13]
RO-319790 DML3NEU Rheumatoid arthritis FA20 Terminated [14]
SC-44463 DMBPNKT N. A. N. A. Terminated [15]
⏷ Show the Full List of 7 Discontinued Drug(s)
1 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
DX-2802 DM8YSW7 Solid tumour/cancer 2A00-2F9Z Preclinical [11]
34 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(+/-)5-(biphenyl-4-yl)-3-hydroxypentanoic acid DMSN7GJ Discovery agent N.A. Investigative [16]
2-(4'-chloro-biphenyl-4-sulfonyl)-pentanoic acid DMQAVM4 Discovery agent N.A. Investigative [17]
2-(biphenyl-4-ylsulfonamido)pentanedioic acid DMH3YBR Discovery agent N.A. Investigative [18]
2-(Biphenyl-4-ylsulfonyl)N-hydroxybenzamide DMCNV5J Discovery agent N.A. Investigative [19]
2-Amino-N,3,3-Trimethylbutanamide DM3YI9P Discovery agent N.A. Investigative [20]
3-(4-(2-phenylethynyl)benzoyl)pentanoic acid DMQDPHT Discovery agent N.A. Investigative [21]
3-(4-Phenylethynylbenzoyl)nonanoic acid DMXL0J5 Discovery agent N.A. Investigative [21]
4-amino-3-(4-(hexyloxy)phenyl)-4-oxobutanoic acid DMGI0YV Discovery agent N.A. Investigative [18]
5-(4-Phenoxy-phenyl)-pyrimidine-2,4,6-trione DM05OMF Discovery agent N.A. Investigative [22]
5-Biphenyl-4-yl-5-ethyl-pyrimidine-2,4,6-trione DMFAITE Discovery agent N.A. Investigative [22]
5-Biphenyl-4-yl-5-hexyl-pyrimidine-2,4,6-trione DMI2PXO Discovery agent N.A. Investigative [22]
5-Hexyl-5-phenyl-pyrimidine-2,4,6-trione DM4S86L Discovery agent N.A. Investigative [22]
5-Methyl-5-phenyl-pyrimidine-2,4,6-trione DMRMKXD Discovery agent N.A. Investigative [22]
ARP100 DM6KQXF Discovery agent N.A. Investigative [23]
Carboxylated glucosamine DM105YR Discovery agent N.A. Investigative [24]
Folate gamma-hydroxamic acid DMJ4F3Q Discovery agent N.A. Investigative [25]
IK-862 DMJA4UE Discovery agent N.A. Investigative [26]
Methotrexate gamma-hydroxamic acid DM8P526 Discovery agent N.A. Investigative [25]
Methotrexate gamma-L-phenylalaninehydroxamic acid DMELK2A Discovery agent N.A. Investigative [25]
Methotrexate gamma-L-proline-hydroxamic acid DMPYJLA Discovery agent N.A. Investigative [25]
MMI270 DM38N2K Discovery agent N.A. Investigative [27]
N-hydroxy-2,3-bis(phenylsulfonamido)propanamide DMZWIVJ Discovery agent N.A. Investigative [28]
N-Hydroxy-2-(4-phenoxy-benzenesulfonyl)benzamide DM4VADN Discovery agent N.A. Investigative [19]
N-hydroxy-3-(2-oxo-2H-chromen-3-yl)propanamide DMWXUCT Discovery agent N.A. Investigative [29]
N-hydroxy-3-(6-methoxy-2-oxo-2H-chromen-3-yl) DMA6EPH Discovery agent N.A. Investigative [29]
PMID15055993C1a DM9V6YK Discovery agent N.A. Investigative [30]
PMID23631440C29e DMM92IB Discovery agent N.A. Investigative [31]
Ro 28-2653 DMDC4HY Discovery agent N.A. Investigative [32]
Ro-37-9790 DM83QMZ Discovery agent N.A. Investigative [33]
Roche 28-2653 DMD4JHK Discovery agent N.A. Investigative [32]
SL422 DM3I2US Discovery agent N.A. Investigative [34]
SR-973 DMU48OD Discovery agent N.A. Investigative [35]
UK-356618 DM02FGH Discovery agent N.A. Investigative [36]
[2-(Biphenyl-4-sulfonyl)phenyl]acetic Acid DM37C25 Discovery agent N.A. Investigative [19]
⏷ Show the Full List of 34 Investigative Drug(s)

References

1 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
2 Synthesis and biological evaluation of curcuminoid pyrazoles as new therapeutic agents in inflammatory bowel disease: effect on matrix metalloprote... Bioorg Med Chem. 2009 Feb 1;17(3):1290-6.
3 DP-b99 modulates matrix metalloproteinase activity and neuronal plasticity. PLoS One. 2014 Jun 11;9(6):e99789.
4 National Cancer Institute Drug Dictionary (drug id 747683).
5 Antibodies and venom peptides: new modalities for ion channels. Nat Rev Drug Discov. 2019 May;18(5):339-357.
6 Neovastat, a naturally occurring multifunctional antiangiogenic drug, in phase III clinical trials. Semin Oncol. 2001 Dec;28(6):620-5.
7 Gelatinase inhibitors: a patent review (2011-2017).Expert Opin Ther Pat. 2018 Jan;28(1):31-46.
8 Inhibitory effect of DA-125, a new anthracyclin analog antitumor agent, on the invasion of human fibrosarcoma cells by down-regulating the matrix m... Biochem Pharmacol. 2005 Dec 19;71(1-2):21-31.
9 Introduction of the 4-(4-bromophenyl)benzenesulfonyl group to hydrazide analogs of Ilomastat leads to potent gelatinase B (MMP-9) inhibitors with i... Bioorg Med Chem. 2008 Sep 15;16(18):8745-59.
10 Structure-based design of potent and selective inhibitors of collagenase-3 (MMP-13). Bioorg Med Chem Lett. 2005 Feb 15;15(4):1101-6.
11 Clinical pipeline report, company report or official report of DeepDyve.
12 Clinical potential of matrix metalloprotease inhibitors. Drugs R D. 1999 Feb;1(2):117-29.
13 Conversion of highly malignant colon cancer from an aggressive to a controlled disease by oral administration of a metalloproteinase inhibitor. Clin Exp Metastasis. 1997 Mar;15(2):184-95.
14 The asymmetric synthesis and in vitro characterization of succinyl mercaptoalcohol and mercaptoketone inhibitors of matrix metalloproteinases. Bioorg Med Chem Lett. 1998 May 19;8(10):1163-8.
15 Design and synthesis of a series of (2R)-N(4)-hydroxy-2-(3-hydroxybenzyl)-N(1)- [(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]butanediamide derivati... J Med Chem. 2001 Oct 11;44(21):3347-50.
16 The identification of beta-hydroxy carboxylic acids as selective MMP-12 inhibitors. Bioorg Med Chem Lett. 2009 Oct 1;19(19):5760-3.
17 Synthesis and SAR of alpha-sulfonylcarboxylic acids as potent matrix metalloproteinase inhibitors. Bioorg Med Chem Lett. 2006 Jun 15;16(12):3096-100.
18 Ranking the selectivity of PubChem screening hits by activity-based protein profiling: MMP13 as a case study. Bioorg Med Chem. 2009 Feb 1;17(3):1101-8.
19 Design, synthesis, biological evaluation, and NMR studies of a new series of arylsulfones as selective and potent matrix metalloproteinase-12 inhib... J Med Chem. 2009 Oct 22;52(20):6347-61.
20 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
21 Selective inhibition of matrix metalloproteinase isozymes and in vivo protection against emphysema by substituted gamma-keto carboxylic acids. J Med Chem. 2006 Jan 26;49(2):456-8.
22 Novel 5,5-disubstitutedpyrimidine-2,4,6-triones as selective MMP inhibitors. Bioorg Med Chem Lett. 2001 Apr 23;11(8):969-72.
23 Amber force field implementation, molecular modelling study, synthesis and MMP-1/MMP-2 inhibition profile of (R)- and (S)-N-hydroxy-2-(N-isopropoxy... Bioorg Med Chem. 2006 Jun 15;14(12):4260-76.
24 Carboxy derivatized glucosamine is a potent inhibitor of matrix metalloproteinase-9 in HT1080 cells. Bioorg Med Chem Lett. 2006 Jun 15;16(12):3105-10.
25 Methotrexate gamma-hydroxamate derivatives as potential dual target antitumor drugs. Bioorg Med Chem. 2007 Feb 1;15(3):1266-74.
26 Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structu... J Med Chem. 2002 Nov 7;45(23):4954-7.
27 Picking the S1, S1' and S2' pockets of matrix metalloproteinases. A niche for potent acyclic sulfonamide inhibitors. Bioorg Med Chem Lett. 1999 Jun 21;9(12):1691-6.
28 Novel bis-(arylsulfonamide) hydroxamate-based selective MMP inhibitors. Bioorg Med Chem Lett. 2008 Jun 1;18(11):3333-7.
29 Chromen-based TNF-alpha converting enzyme (TACE) inhibitors: design, synthesis, and biological evaluation. Bioorg Med Chem. 2008 Jan 1;16(1):530-5.
30 Azasugar-based MMP/ADAM inhibitors as antipsoriatic agents. J Med Chem. 2004 Apr 8;47(8):1930-8.
31 Matrix metalloproteinase inhibitors based on the 3-mercaptopyrrolidine core. J Med Chem. 2013 Jun 13;56(11):4357-73.
32 The new synthetic matrix metalloproteinase inhibitor (Roche 28-2653) reduces tumor growth and prolongs survival in a prostate cancer standard rat model. Oncogene. 2002 Mar 27;21(13):2089-96.
33 11,21-Bisphenyl-19-norpregnane derivatives are selective antiglucocorticoids, Bioorg. Med. Chem. Lett. 7(17):2299-2302 (1997).
34 Design, synthesis, and structure-activity relationships of macrocyclic hydroxamic acids that inhibit tumor necrosis factor alpha release in vitro and in vivo. J Med Chem. 2001 Aug 2;44(16):2636-60.
35 Synthesis and evaluation of succinoyl-caprolactam gamma-secretase inhibitors. Bioorg Med Chem Lett. 2006 May 1;16(9):2357-63.
36 A potent, selective inhibitor of matrix metalloproteinase-3 for the topical treatment of chronic dermal ulcers. J Med Chem. 2003 Jul 31;46(16):3514-25.
37 Matrix metalloproteinase-9 reduces islet amyloid formation by degrading islet amyloid polypeptide. J Biol Chem. 2013 Feb 1;288(5):3553-9.