Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEAXY04)

DME Name Delta(24)-sterol reductase (DHCR24)
Synonyms Diminuto/dwarf1 homolog; 24-dehydrocholesterol reductase; 3-beta-hydroxysterol Delta-24-reductase; DHCR24; KIAA0018; Seladin-1
Gene Name DHCR24
UniProt ID
DHC24_HUMAN
INTEDE ID
DME0413
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1718
EC Number EC: 1.3.1.72
Oxidoreductase
CH-CH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.3.1.72
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MEPAVSLAVCALLFLLWVRLKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKL
SSAPRLHEQRVRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYKKTHKNIMINLMD
ILEVDTKKQIVRVEPLVTMGQVTALLTSIGWTLPVLPELDDLTVGGLIMGTGIESSSHKY
GLFQHICTAYELVLADGSFVRCTPSENSDLFYAVPWSCGTLGFLVAAEIRIIPAKKYVKL
RFEPVRGLEAICAKFTHESQRQENHFVEGLLYSLDEAVIMTGVMTDEAEPSKLNSIGNYY
KPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVP
PKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQ
PGLVHPKGNEAELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE
FWEMFDGSLYHKLREKLGCQDAFPEVYDKICKAARH
Function
This enzyme catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. In addition to its cholesterol-synthesizing activity, it can protects cells from oxidative stress by reducing caspase 3 activity during apoptosis induced by oxidative stress and protects against amyloid-beta peptide-induced apoptosis.
KEGG Pathway
( )
( )
Reactome Pathway
Cholesterol biosynthesis via lathosterol (R-HSA-6807062 )
Cholesterol biosynthesis via desmosterol (R-HSA-6807047 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Desmosterol DMV8SUM Discovery agent N.A. Investigative [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.25E-19 5.51E-01 1.22E+00
Alopecia ED70 Skin from scalp 9.86E-01 1.65E-02 1.04E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.47E-02 -2.35E-01 -4.47E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.07E-01 5.02E-01 1.22E+00
Aortic stenosis BB70 Calcified aortic valve 8.34E-01 -2.31E-01 -3.74E-01
Apnea 7A40 Hyperplastic tonsil 4.17E-01 -3.36E-01 -1.03E+00
Arthropathy FA00-FA5Z Peripheral blood 4.49E-01 -1.48E-02 -4.93E-02
Asthma CA23 Nasal and bronchial airway 1.22E-04 3.49E-01 5.41E-01
Atopic dermatitis EA80 Skin 2.76E-02 -1.06E-01 -2.64E-01
Autism 6A02 Whole blood 7.90E-02 -6.61E-02 -2.51E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.94E-01 -3.72E-02 -3.00E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.49E-01 4.85E-02 2.72E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.56E-01 -5.47E-02 -1.51E-01
Batten disease 5C56.1 Whole blood 7.15E-01 1.48E-01 9.44E-01
Behcet's disease 4A62 Peripheral blood 8.00E-01 -4.43E-02 -1.77E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.47E-01 -6.02E-02 -1.89E-01
Bladder cancer 2C94 Bladder tissue 2.47E-02 3.20E-01 1.05E+00
Breast cancer 2C60-2C6Z Breast tissue 2.03E-22 6.84E-01 9.66E-01
Cardioembolic stroke 8B11.20 Whole blood 9.20E-02 -3.69E-01 -9.03E-01
Cervical cancer 2C77 Cervical tissue 1.79E-03 -2.67E-01 -7.15E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.87E-01 1.98E-02 8.54E-02
Chronic hepatitis C 1E51.1 Whole blood 5.78E-01 1.10E-02 3.12E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 5.08E-02 -1.26E-01 -4.25E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.77E-03 -3.16E-01 -8.51E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.50E-01 -7.07E-01 -7.63E-01
Colon cancer 2B90 Colon tissue 4.25E-10 -2.93E-01 -6.13E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.22E-02 2.02E-01 1.49E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.62E-01 -5.54E-02 -1.23E-01
Endometriosis GA10 Endometrium tissue 9.98E-02 7.96E-01 7.75E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.83E-02 3.48E-01 1.00E+00
Familial hypercholesterolemia 5C80.00 Whole blood 2.23E-01 5.78E-02 2.24E-01
Gastric cancer 2B72 Gastric tissue 8.33E-01 -7.50E-01 -5.07E-01
Glioblastopma 2A00.00 Nervous tissue 9.19E-192 -1.63E+00 -2.61E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.05E-01 -1.87E+00 -3.32E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.43E-01 -4.66E-01 -5.48E-01
Head and neck cancer 2D42 Head and neck tissue 1.14E-17 -8.10E-01 -1.18E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.54E-01 5.15E-02 6.06E-02
Huntington's disease 8A01.10 Whole blood 4.14E-01 -1.96E-01 -7.03E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.74E-01 -1.46E-01 -2.81E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.08E-04 4.14E-01 3.27E+00
Influenza 1E30 Whole blood 1.06E-01 -4.70E-01 -1.43E+00
Interstitial cystitis GC00.3 Bladder tissue 1.01E-03 -1.27E+00 -9.85E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.53E-01 0.00E+00 0.00E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.98E-01 1.32E-02 3.56E-02
Ischemic stroke 8B11 Peripheral blood 2.56E-01 -1.58E-01 -6.26E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.04E-01 -1.58E-01 -3.82E-01
Lateral sclerosis 8B60.4 Skin 3.60E-01 2.91E-01 3.29E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.38E-02 -6.33E-01 -1.30E+00
Liver cancer 2C12.0 Liver tissue 5.09E-01 1.68E-01 4.74E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.52E-05 -2.50E+00 -4.72E+00
Lung cancer 2C25 Lung tissue 6.88E-62 -7.34E-01 -1.77E+00
Lupus erythematosus 4A40 Whole blood 1.12E-02 2.30E-01 2.60E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.04E-01 1.05E-01 3.32E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.33E-01 -6.46E-02 -1.33E-01
Melanoma 2C30 Skin 5.47E-05 -1.52E+00 -1.14E+00
Multiple myeloma 2A83.1 Peripheral blood 4.62E-01 -2.73E-01 -1.47E-01
Multiple myeloma 2A83.1 Bone marrow 6.41E-03 2.24E-01 1.20E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.04E-01 2.93E-02 6.36E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.48E-02 -2.02E-02 -3.56E-02
Myelofibrosis 2A20.2 Whole blood 2.45E-01 -5.22E-03 -4.57E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.41E-01 -3.80E-01 -3.90E-01
Myopathy 8C70.6 Muscle tissue 7.35E-01 -1.93E-01 -3.91E-01
Neonatal sepsis KA60 Whole blood 4.76E-17 4.56E-01 1.46E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.01E-15 -3.13E+00 -8.10E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.81E-01 1.16E-02 2.96E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.70E-02 -4.50E-01 -1.92E+00
Olive pollen allergy CA08.00 Peripheral blood 7.60E-01 2.89E-02 1.29E-01
Oral cancer 2B6E Oral tissue 5.49E-01 -3.23E-01 -2.87E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.02E-01 -4.58E-01 -4.41E-01
Osteoporosis FB83.1 Bone marrow 4.98E-01 -4.33E-03 -6.61E-03
Ovarian cancer 2C73 Ovarian tissue 3.13E-02 9.21E-01 5.60E-01
Pancreatic cancer 2C10 Pancreas 2.49E-04 6.19E-01 8.48E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.29E-01 -1.53E-02 -2.23E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.52E-03 3.61E-01 1.24E+00
Pituitary cancer 2D12 Pituitary tissue 4.04E-02 1.23E+00 1.47E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.86E-03 2.30E+00 3.73E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.81E-03 3.81E-01 1.37E+00
Polycythemia vera 2A20.4 Whole blood 1.63E-03 -6.26E-02 -5.82E-01
Pompe disease 5C51.3 Biceps muscle 4.32E-02 -8.40E-01 -2.01E+00
Preterm birth KA21.4Z Myometrium 5.10E-01 2.73E-01 6.25E-01
Prostate cancer 2C82 Prostate 2.04E-03 6.81E-01 1.14E+00
Psoriasis EA90 Skin 1.01E-01 1.09E-01 2.10E-01
Rectal cancer 2B92 Rectal colon tissue 3.39E-01 -1.52E-01 -3.01E-01
Renal cancer 2C90-2C91 Kidney 5.69E-01 -1.12E-01 -3.76E-01
Retinoblastoma 2D02.2 Uvea 3.93E-03 -1.89E+00 -1.59E+00
Rheumatoid arthritis FA20 Synovial tissue 2.29E-01 3.04E-01 5.47E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.85E-02 -5.23E-02 -3.43E-01
Schizophrenia 6A20 Prefrontal cortex 2.02E-02 -2.12E-01 -1.52E-01
Schizophrenia 6A20 Superior temporal cortex 2.39E-01 -2.82E-01 -4.45E-01
Scleroderma 4A42.Z Whole blood 9.93E-01 -6.10E-03 -2.91E-02
Seizure 8A60-8A6Z Whole blood 9.75E-01 7.23E-02 1.92E-01
Sensitive skin EK0Z Skin 9.77E-01 -1.45E-01 -7.91E-01
Sepsis with septic shock 1G41 Whole blood 4.55E-47 4.54E-01 1.43E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.31E-01 2.14E-02 9.95E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.42E-01 0.00E+00 0.00E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 6.89E-01 -1.27E-01 -2.62E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.84E-01 7.70E-02 6.46E-01
Skin cancer 2C30-2C3Z Skin 4.28E-68 -1.56E+00 -2.39E+00
Thrombocythemia 3B63 Whole blood 4.30E-01 2.14E-02 1.96E-01
Thrombocytopenia 3B64 Whole blood 2.47E-01 3.96E-01 6.94E-01
Thyroid cancer 2D10 Thyroid 1.30E-04 3.74E-01 8.06E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.24E-10 -2.07E+00 -3.78E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.18E-02 -5.46E-01 -2.32E+00
Type 2 diabetes 5A11 Liver tissue 9.64E-01 -1.44E-01 -5.66E-01
Ureter cancer 2C92 Urothelium 4.77E-01 -2.17E-01 -7.24E-01
Uterine cancer 2C78 Endometrium tissue 9.59E-04 6.73E-01 4.89E-01
Vitiligo ED63.0 Skin 3.86E-01 -1.05E-01 -6.41E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Delta(24)-sterol reductase (DHCR24) DTT Info
DME DTT Type Literature-reported
1 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
T-226293 DM7Y4GT Obesity 5B81 Preclinical [1]
1 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Diazacholesterol DM5DPM4 Discovery agent N.A. Investigative [1]

References

1 Antilipemic drug-induced skin manifestations. Hautarzt. 1995 Feb;46(2):76-80.
2 Alzheimer's disease: brain desmosterol levels. J Alzheimers Dis. 2013;33(3):881-8.