Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEAXY04)

DME Name	Delta(24)-sterol reductase (DHCR24)
Synonyms	Diminuto/dwarf1 homolog; 24-dehydrocholesterol reductase; 3-beta-hydroxysterol Delta-24-reductase; DHCR24; KIAA0018; Seladin-1
Gene Name	DHCR24
UniProt ID	DHC24_HUMAN
INTEDE ID	DME0413
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	1718
EC Number	EC: 1.3.1.72 Oxidoreductase CH-CH donor oxidoreductase NAD/NADP acceptor oxidoreductase EC: 1.3.1.72
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MEPAVSLAVCALLFLLWVRLKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKL SSAPRLHEQRVRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYKKTHKNIMINLMD ILEVDTKKQIVRVEPLVTMGQVTALLTSIGWTLPVLPELDDLTVGGLIMGTGIESSSHKY GLFQHICTAYELVLADGSFVRCTPSENSDLFYAVPWSCGTLGFLVAAEIRIIPAKKYVKL RFEPVRGLEAICAKFTHESQRQENHFVEGLLYSLDEAVIMTGVMTDEAEPSKLNSIGNYY KPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVP PKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQ PGLVHPKGNEAELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE FWEMFDGSLYHKLREKLGCQDAFPEVYDKICKAARH
Function	This enzyme catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. In addition to its cholesterol-synthesizing activity, it can protects cells from oxidative stress by reducing caspase 3 activity during apoptosis induced by oxidative stress and protects against amyloid-beta peptide-induced apoptosis.
KEGG Pathway	Metabolic pathways (hsa01100 ) Steroid biosynthesis (hsa00100 )
Reactome Pathway	Cholesterol biosynthesis via lathosterol (R-HSA-6807062 ) Cholesterol biosynthesis via desmosterol (R-HSA-6807047 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DME

1 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
desmosterol	DMV8SUM	Discovery agent	N.A.	Investigative	[2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	3.25E-19	5.51E-01	1.22E+00
Alopecia	ED70	Skin from scalp	9.86E-01	1.65E-02	1.04E-01
Alzheimer's disease	8A20	Entorhinal cortex	1.47E-02	-2.35E-01	-4.47E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	4.07E-01	5.02E-01	1.22E+00
Aortic stenosis	BB70	Calcified aortic valve	8.34E-01	-2.31E-01	-3.74E-01
Apnea	7A40	Hyperplastic tonsil	4.17E-01	-3.36E-01	-1.03E+00
Arthropathy	FA00-FA5Z	Peripheral blood	4.49E-01	-1.48E-02	-4.93E-02
Asthma	CA23	Nasal and bronchial airway	1.22E-04	3.49E-01	5.41E-01
Atopic dermatitis	EA80	Skin	2.76E-02	-1.06E-01	-2.64E-01
Autism	6A02	Whole blood	7.90E-02	-6.61E-02	-2.51E-01
Autoimmune uveitis	9A96	Peripheral monocyte	7.94E-01	-3.72E-02	-3.00E-01
Autosomal dominant monocytopenia	4B04	Whole blood	4.49E-01	4.85E-02	2.72E-01
Bacterial infection of gingival	1C1H	Gingival tissue	1.56E-01	-5.47E-02	-1.51E-01
Batten disease	5C56.1	Whole blood	7.15E-01	1.48E-01	9.44E-01
Behcet's disease	4A62	Peripheral blood	8.00E-01	-4.43E-02	-1.77E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	3.47E-01	-6.02E-02	-1.89E-01
Bladder cancer	2C94	Bladder tissue	2.47E-02	3.20E-01	1.05E+00
Breast cancer	2C60-2C6Z	Breast tissue	2.03E-22	6.84E-01	9.66E-01
Cardioembolic stroke	8B11.20	Whole blood	9.20E-02	-3.69E-01	-9.03E-01
Cervical cancer	2C77	Cervical tissue	1.79E-03	-2.67E-01	-7.15E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	4.87E-01	1.98E-02	8.54E-02
Chronic hepatitis C	1E51.1	Whole blood	5.78E-01	1.10E-02	3.12E-02
Chronic obstructive pulmonary disease	CA22	Lung tissue	5.08E-02	-1.26E-01	-4.25E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.77E-03	-3.16E-01	-8.51E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	1.50E-01	-7.07E-01	-7.63E-01
Colon cancer	2B90	Colon tissue	4.25E-10	-2.93E-01	-6.13E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	4.22E-02	2.02E-01	1.49E+00
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	7.62E-01	-5.54E-02	-1.23E-01
Endometriosis	GA10	Endometrium tissue	9.98E-02	7.96E-01	7.75E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	5.83E-02	3.48E-01	1.00E+00
Familial hypercholesterolemia	5C80.00	Whole blood	2.23E-01	5.78E-02	2.24E-01
Gastric cancer	2B72	Gastric tissue	8.33E-01	-7.50E-01	-5.07E-01
Glioblastopma	2A00.00	Nervous tissue	9.19E-192	-1.63E+00	-2.61E+00
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	1.05E-01	-1.87E+00	-3.32E+00
Glioma	2A00.0Y-2A00.0Z	White matter tissue	8.43E-01	-4.66E-01	-5.48E-01
Head and neck cancer	2D42	Head and neck tissue	1.14E-17	-8.10E-01	-1.18E+00
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	7.54E-01	5.15E-02	6.06E-02
Huntington's disease	8A01.10	Whole blood	4.14E-01	-1.96E-01	-7.03E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	2.74E-01	-1.46E-01	-2.81E-01
Immunodeficiency	4A00-4A20	Peripheral blood	2.08E-04	4.14E-01	3.27E+00
Influenza	1E30	Whole blood	1.06E-01	-4.70E-01	-1.43E+00
Interstitial cystitis	GC00.3	Bladder tissue	1.01E-03	-1.27E+00	-9.85E+00
Intracranial aneurysm	8B01.0	Intracranial artery	4.53E-01	0.00E+00	0.00E+00
Irritable bowel syndrome	DD91.0	Rectal colon tissue	1.98E-01	1.32E-02	3.56E-02
Ischemic stroke	8B11	Peripheral blood	2.56E-01	-1.58E-01	-6.26E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	2.04E-01	-1.58E-01	-3.82E-01
Lateral sclerosis	8B60.4	Skin	3.60E-01	2.91E-01	3.29E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	1.38E-02	-6.33E-01	-1.30E+00
Liver cancer	2C12.0	Liver tissue	5.09E-01	1.68E-01	4.74E-01
Liver failure	DB99.7-DB99.8	Liver tissue	4.52E-05	-2.50E+00	-4.72E+00
Lung cancer	2C25	Lung tissue	6.88E-62	-7.34E-01	-1.77E+00
Lupus erythematosus	4A40	Whole blood	1.12E-02	2.30E-01	2.60E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	3.04E-01	1.05E-01	3.32E-01
Major depressive disorder	6A70-6A7Z	Whole blood	3.33E-01	-6.46E-02	-1.33E-01
Melanoma	2C30	Skin	5.47E-05	-1.52E+00	-1.14E+00
Multiple myeloma	2A83.1	Peripheral blood	4.62E-01	-2.73E-01	-1.47E-01
Multiple myeloma	2A83.1	Bone marrow	6.41E-03	2.24E-01	1.20E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	9.04E-01	2.93E-02	6.36E-02
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	9.48E-02	-2.02E-02	-3.56E-02
Myelofibrosis	2A20.2	Whole blood	2.45E-01	-5.22E-03	-4.57E-02
Myocardial infarction	BA41-BA50	Peripheral blood	1.41E-01	-3.80E-01	-3.90E-01
Myopathy	8C70.6	Muscle tissue	7.35E-01	-1.93E-01	-3.91E-01
Neonatal sepsis	KA60	Whole blood	4.76E-17	4.56E-01	1.46E+00
Neuroectodermal tumour	2A00.11	Brain stem tissue	5.01E-15	-3.13E+00	-8.10E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	6.81E-01	1.16E-02	2.96E-02
Obesity related type 2 diabetes	5A11	Omental adipose tissue	7.70E-02	-4.50E-01	-1.92E+00
Olive pollen allergy	CA08.00	Peripheral blood	7.60E-01	2.89E-02	1.29E-01
Oral cancer	2B6E	Oral tissue	5.49E-01	-3.23E-01	-2.87E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	5.02E-01	-4.58E-01	-4.41E-01
Osteoporosis	FB83.1	Bone marrow	4.98E-01	-4.33E-03	-6.61E-03
Ovarian cancer	2C73	Ovarian tissue	3.13E-02	9.21E-01	5.60E-01
Pancreatic cancer	2C10	Pancreas	2.49E-04	6.19E-01	8.48E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	3.29E-01	-1.53E-02	-2.23E-02
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	2.52E-03	3.61E-01	1.24E+00
Pituitary cancer	2D12	Pituitary tissue	4.04E-02	1.23E+00	1.47E+00
Pituitary gonadotrope tumour	2D12	Pituitary tissue	2.86E-03	2.30E+00	3.73E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	3.81E-03	3.81E-01	1.37E+00
Polycythemia vera	2A20.4	Whole blood	1.63E-03	-6.26E-02	-5.82E-01
Pompe disease	5C51.3	Biceps muscle	4.32E-02	-8.40E-01	-2.01E+00
Preterm birth	KA21.4Z	Myometrium	5.10E-01	2.73E-01	6.25E-01
Prostate cancer	2C82	Prostate	2.04E-03	6.81E-01	1.14E+00
Psoriasis	EA90	Skin	1.01E-01	1.09E-01	2.10E-01
Rectal cancer	2B92	Rectal colon tissue	3.39E-01	-1.52E-01	-3.01E-01
Renal cancer	2C90-2C91	Kidney	5.69E-01	-1.12E-01	-3.76E-01
Retinoblastoma	2D02.2	Uvea	3.93E-03	-1.89E+00	-1.59E+00
Rheumatoid arthritis	FA20	Synovial tissue	2.29E-01	3.04E-01	5.47E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	3.85E-02	-5.23E-02	-3.43E-01
Schizophrenia	6A20	Prefrontal cortex	2.02E-02	-2.12E-01	-1.52E-01
Schizophrenia	6A20	Superior temporal cortex	2.39E-01	-2.82E-01	-4.45E-01
Scleroderma	4A42.Z	Whole blood	9.93E-01	-6.10E-03	-2.91E-02
Seizure	8A60-8A6Z	Whole blood	9.75E-01	7.23E-02	1.92E-01
Sensitive skin	EK0Z	Skin	9.77E-01	-1.45E-01	-7.91E-01
Sepsis with septic shock	1G41	Whole blood	4.55E-47	4.54E-01	1.43E+00
Shwachman-Diamond syndrome	3A70.0	Bone marrow	8.31E-01	2.14E-02	9.95E-02
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	9.42E-01	0.00E+00	0.00E+00
Simpson golabi behmel syndrome	LD2C	Adipose tissue	6.89E-01	-1.27E-01	-2.62E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	7.84E-01	7.70E-02	6.46E-01
Skin cancer	2C30-2C3Z	Skin	4.28E-68	-1.56E+00	-2.39E+00
Thrombocythemia	3B63	Whole blood	4.30E-01	2.14E-02	1.96E-01
Thrombocytopenia	3B64	Whole blood	2.47E-01	3.96E-01	6.94E-01
Thyroid cancer	2D10	Thyroid	1.30E-04	3.74E-01	8.06E-01
Tibial muscular dystrophy	8C75	Muscle tissue	9.24E-10	-2.07E+00	-3.78E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	2.18E-02	-5.46E-01	-2.32E+00
Type 2 diabetes	5A11	Liver tissue	9.64E-01	-1.44E-01	-5.66E-01
Ureter cancer	2C92	Urothelium	4.77E-01	-2.17E-01	-7.24E-01
Uterine cancer	2C78	Endometrium tissue	9.59E-04	6.73E-01	4.89E-01
Vitiligo	ED63.0	Skin	3.86E-01	-1.05E-01	-6.41E-01
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name

Delta(24)-sterol reductase (DHCR24) DTT Info

DME DTT Type

Literature-reported

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
T-226293	DM7Y4GT	Obesity	5B81	Preclinical	[1]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Diazacholesterol	DM5DPM4	Discovery agent	N.A.	Investigative	[1]
------------------------------------------------------------------------------------

References

1	Antilipemic drug-induced skin manifestations. Hautarzt. 1995 Feb;46(2):76-80.
2	Alzheimer's disease: brain desmosterol levels. J Alzheimers Dis. 2013;33(3):881-8.