General Information of Drug-Metabolizing Enzyme (DME) (ID: DEGTB1K)

DME Name Dehydrogenase/reductase retSDR3 (HSD17B14)
Synonyms
Retinal short-chain dehydrogenase/reductase retSDR3; Short chain dehydrogenase/reductase family 47C member 1; Dehydrogenase/reductase SDR family member 10; 17-beta-hydroxysteroid dehydrogenase 14; 17-beta-hydroxysteroid dehydrogenase DHRS10; UNQ502/PRO474; 17-beta-HSD 14; HSD17B14; SDR3; SDR47C1; DHRS10
Gene Name HSD17B14
UniProt ID
DHB14_HUMAN
INTEDE ID
DME0609
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51171
EC Number EC: 1.1.1.62
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.62
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFIL
CDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYT
LTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVN
CISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTG
IELLVTGGAELGYGCKASRSTPVDAPDIPS
Function This enzyme has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. And it converts oestradiol to oestrone.
Reactome Pathway
Estrogen biosynthesis (R-HSA-193144 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Estradiol DMUNTE3 Acne vulgaris ED80 Approved [1]
Testosterone cypionate DMC1TEV N. A. N. A. Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.55E-03 8.66E-02 3.39E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.72E-05 1.56E-01 5.66E-01
Asthma CA23 Nasal and bronchial airway 7.71E-01 -1.59E-02 -4.62E-02
Behcet's disease 4A62 Peripheral blood 7.46E-01 -7.35E-02 -2.68E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.08E-01 -5.02E-02 -3.13E-01
Bladder cancer 2C94 Bladder tissue 8.26E-03 -4.25E-01 -1.52E+00
Breast cancer 2C60-2C6Z Breast tissue 9.56E-01 -6.56E-02 -1.60E-01
Colon cancer 2B90 Colon tissue 2.94E-11 -2.25E-01 -6.93E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.57E-02 -2.53E-01 -1.32E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.52E-01 -3.67E-02 -1.49E-01
Gastric cancer 2B72 Gastric tissue 3.91E-01 -1.74E-01 -9.98E-01
Glioblastopma 2A00.00 Nervous tissue 1.37E-13 -1.59E-01 -4.10E-01
Head and neck cancer 2D42 Head and neck tissue 4.71E-10 2.49E-01 7.11E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.15E-01 6.24E-02 3.38E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.08E-01 1.70E-01 3.56E-01
Interstitial cystitis GC00.3 Bladder tissue 6.48E-02 -3.82E-01 -1.09E+00
Ischemic stroke 8B11 Peripheral blood 3.92E-01 5.52E-02 4.06E-01
Liver cancer 2C12.0 Liver tissue 1.20E-09 -1.33E+00 -1.57E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.59E-01 -3.25E-01 -4.40E-01
Lung cancer 2C25 Lung tissue 1.95E-13 -3.00E-01 -7.35E-01
Lupus erythematosus 4A40 Whole blood 9.37E-04 -1.53E-01 -3.24E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.83E-02 -1.13E-01 -7.42E-01
Multiple myeloma 2A83.1 Bone marrow 4.03E-02 2.80E-01 9.12E-01
Multiple myeloma 2A83.1 Peripheral blood 4.76E-01 -3.39E-02 -1.59E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.30E-02 9.95E-02 8.37E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.15E-02 1.83E-01 4.37E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.48E-02 1.23E-01 3.90E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.25E-11 -1.40E+00 -5.41E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.07E-01 3.51E-01 6.18E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.57E-01 1.13E-01 7.40E-01
Olive pollen allergy CA08.00 Peripheral blood 1.54E-01 2.83E-01 9.68E-01
Oral cancer 2B6E Oral tissue 2.65E-03 -3.55E-01 -7.20E-01
Ovarian cancer 2C73 Ovarian tissue 3.81E-06 -8.12E-01 -3.58E+00
Pancreatic cancer 2C10 Pancreas 1.08E-02 4.00E-01 9.42E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.80E-01 1.83E-01 5.30E-01
Pituitary cancer 2D12 Pituitary tissue 5.07E-06 7.73E-01 2.60E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.29E-01 -4.73E-02 -2.30E-01
Pompe disease 5C51.3 Biceps muscle 6.23E-03 3.28E-01 2.64E+00
Prostate cancer 2C82 Prostate 9.80E-02 -4.63E-01 -7.10E-01
Psoriasis EA90 Skin 2.06E-12 -2.34E-01 -5.86E-01
Rectal cancer 2B92 Rectal colon tissue 6.23E-02 -1.90E-01 -8.95E-01
Renal cancer 2C90-2C91 Kidney 9.15E-02 -5.83E-01 -7.76E-01
Retinoblastoma 2D02.2 Uvea 3.17E-07 1.74E+00 4.39E+00
Schizophrenia 6A20 Prefrontal cortex 9.58E-02 -1.47E-01 -3.81E-01
Schizophrenia 6A20 Superior temporal cortex 4.73E-01 -2.24E-02 -1.34E-01
Scleroderma 4A42.Z Whole blood 7.55E-06 -2.64E-01 -2.44E+00
Seizure 8A60-8A6Z Whole blood 9.77E-01 -1.42E-01 -5.03E-01
Sepsis with septic shock 1G41 Whole blood 9.73E-02 7.42E-02 2.61E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.22E-01 1.22E-01 3.10E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.79E-01 -1.01E-01 -1.59E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.30E-01 4.05E-01 1.15E+00
Skin cancer 2C30-2C3Z Skin 3.67E-07 1.12E-01 2.28E-01
Thrombocythemia 3B63 Whole blood 7.96E-02 1.06E-01 6.60E-01
Thrombocytopenia 3B64 Whole blood 4.44E-01 2.71E-01 5.56E-01
Thyroid cancer 2D10 Thyroid 3.50E-20 -8.89E-01 -1.93E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.29E-02 -1.32E-01 -5.26E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.91E-02 4.40E-01 1.83E+00
Type 2 diabetes 5A11 Liver tissue 1.96E-01 -2.61E-01 -1.17E+00
Ureter cancer 2C92 Urothelium 5.02E-01 1.12E-01 3.98E-01
Uterine cancer 2C78 Endometrium tissue 2.88E-04 -4.08E-01 -5.61E-01
Vitiligo ED63.0 Skin 2.25E-01 -3.41E-02 -9.35E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Expression patterns of 17beta-hydroxysteroid dehydrogenase 14 in human tissues. Horm Metab Res. 2012 Dec;44(13):949-56.