Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEHGR57)

DME Name Hydroxyindole O-methyltransferase (ASMT)
Synonyms Acetylserotonin O-methyltransferase; Hydroxyindolemethyltransferase; Hydroxyindole-O-methyl transferase; Hydroxyindole-O-methyltransferase; HIOMT; ASMT
Gene Name ASMT
UniProt ID
ASMT_HUMAN
INTEDE ID
DME0182
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
438
EC Number EC: 2.1.1.4
Transferase
Methylase
Methyltransferase
EC: 2.1.1.4
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGT
ELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHL
ADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVF
PLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKD
PLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYS
LNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK
Function This enzyme catalyzes the transfer of a methyl group onto N- acetylserotonin, producing melatonin (N-acetyl-5-methoxytryptamine).
KEGG Pathway
Metabolic pathways (hsa01100 )
Tryptophan metabolism (hsa00380 )
Reactome Pathway
Serotonin and melatonin biosynthesis (R-HSA-209931 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Melatonin DMKWFBT Depression 6A70-6A7Z Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.12E-04 -1.41E-02 -7.34E-02
Alopecia ED70 Skin from scalp 2.86E-01 -6.57E-02 -2.67E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.31E-01 -2.47E-02 -2.05E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.66E-01 1.20E-02 9.52E-02
Aortic stenosis BB70 Calcified aortic valve 7.90E-01 -1.10E-01 -2.25E-01
Apnea 7A40 Hyperplastic tonsil 5.80E-01 -6.97E-02 -4.77E-01
Arthropathy FA00-FA5Z Peripheral blood 5.56E-01 8.96E-03 9.15E-02
Asthma CA23 Nasal and bronchial airway 8.32E-02 3.30E-02 1.63E-01
Atopic dermatitis EA80 Skin 9.00E-01 1.43E-02 2.07E-01
Autism 6A02 Whole blood 2.52E-01 -4.74E-02 -2.51E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.11E-01 1.68E-02 1.23E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.59E-02 1.68E-01 1.05E+00
Bacterial infection of gingival 1C1H Gingival tissue 8.70E-01 2.41E-02 1.29E-01
Batten disease 5C56.1 Whole blood 3.17E-01 7.20E-03 1.03E-01
Behcet's disease 4A62 Peripheral blood 1.15E-01 1.45E-01 1.14E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.76E-01 -5.81E-03 -4.58E-02
Bladder cancer 2C94 Bladder tissue 7.75E-04 6.02E-01 2.47E+00
Breast cancer 2C60-2C6Z Breast tissue 3.59E-10 -7.55E-02 -2.90E-01
Cardioembolic stroke 8B11.20 Whole blood 5.29E-01 -1.21E-01 -5.04E-01
Cervical cancer 2C77 Cervical tissue 4.43E-01 9.56E-02 3.79E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.56E-01 -2.02E-02 -1.01E-01
Chronic hepatitis C 1E51.1 Whole blood 3.27E-01 1.48E-04 1.23E-03
Chronic obstructive pulmonary disease CA22 Lung tissue 2.72E-01 3.29E-03 2.89E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.06E-02 3.73E-02 2.57E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.22E-01 1.06E-02 1.12E-01
Colon cancer 2B90 Colon tissue 3.02E-02 -2.39E-02 -1.23E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.35E-01 -2.20E-02 -1.78E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.03E-01 1.95E-01 1.44E-01
Endometriosis GA10 Endometrium tissue 3.32E-01 2.56E-02 1.48E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.02E-01 3.07E-02 3.01E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.27E-04 -1.19E-01 -5.52E-01
Gastric cancer 2B72 Gastric tissue 5.07E-01 1.80E-01 8.93E-01
Glioblastopma 2A00.00 Nervous tissue 6.57E-01 2.68E-04 1.47E-03
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.11E-01 1.67E-01 1.35E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.12E-05 -3.97E-01 -2.80E+00
Head and neck cancer 2D42 Head and neck tissue 1.01E-02 -5.45E-02 -3.38E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.10E-01 -6.13E-02 -3.38E-01
Huntington's disease 8A01.10 Whole blood 9.37E-01 -2.30E-03 -3.07E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.43E-01 2.57E-02 2.75E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.99E-02 8.35E-02 9.18E-01
Influenza 1E30 Whole blood 1.62E-02 1.68E-01 3.40E+00
Interstitial cystitis GC00.3 Bladder tissue 2.51E-01 6.99E-02 1.01E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.32E-01 -9.33E-02 -5.39E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.03E-01 -8.48E-03 -5.90E-02
Ischemic stroke 8B11 Peripheral blood 1.54E-02 8.09E-02 5.96E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.19E-02 2.57E-02 1.38E-01
Lateral sclerosis 8B60.4 Skin 6.49E-01 1.20E-02 1.12E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.40E-01 1.80E-01 5.79E-01
Liver cancer 2C12.0 Liver tissue 8.16E-01 -7.12E-02 -3.54E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.58E-01 -7.77E-02 -6.79E-01
Lung cancer 2C25 Lung tissue 4.81E-01 -9.40E-03 -6.25E-02
Lupus erythematosus 4A40 Whole blood 5.28E-02 -3.45E-02 -1.15E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.79E-01 5.51E-02 4.15E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.80E-01 2.95E-02 1.47E-01
Melanoma 2C30 Skin 1.60E-01 -6.39E-02 -2.34E-01
Multiple myeloma 2A83.1 Peripheral blood 6.17E-01 2.56E-02 1.81E-01
Multiple myeloma 2A83.1 Bone marrow 1.01E-04 -3.63E-01 -2.76E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.76E-01 5.50E-02 3.24E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.19E-01 -5.35E-02 -3.16E-01
Myelofibrosis 2A20.2 Whole blood 4.57E-03 1.05E-01 1.08E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.58E-02 1.55E-01 4.62E-01
Myopathy 8C70.6 Muscle tissue 2.79E-03 -2.03E-01 -1.85E+00
Neonatal sepsis KA60 Whole blood 8.01E-01 -2.71E-02 -1.58E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.49E-01 6.48E-02 2.15E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.78E-01 9.54E-03 5.32E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.65E-02 1.24E-01 1.31E+00
Olive pollen allergy CA08.00 Peripheral blood 2.96E-01 6.78E-02 5.48E-01
Oral cancer 2B6E Oral tissue 4.08E-09 -4.67E-01 -1.73E+00
Osteoarthritis FA00-FA0Z Synovial tissue 9.37E-02 -5.88E-02 -3.77E-01
Osteoporosis FB83.1 Bone marrow 2.39E-01 8.06E-02 5.74E-01
Ovarian cancer 2C73 Ovarian tissue 1.23E-01 -9.30E-02 -6.18E-01
Pancreatic cancer 2C10 Pancreas 2.03E-02 -1.77E-01 -7.52E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.94E-01 -5.32E-02 -4.28E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.21E-01 -3.45E-02 -3.48E-01
Pituitary cancer 2D12 Pituitary tissue 3.41E-02 1.14E-01 6.65E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.26E-01 7.80E-02 4.59E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.87E-01 -2.86E-03 -1.77E-02
Polycythemia vera 2A20.4 Whole blood 4.07E-08 9.50E-02 9.38E-01
Pompe disease 5C51.3 Biceps muscle 9.71E-02 -8.07E-02 -7.53E-01
Preterm birth KA21.4Z Myometrium 5.98E-01 3.09E-02 3.00E-01
Prostate cancer 2C82 Prostate 4.97E-01 1.18E-01 3.32E-01
Psoriasis EA90 Skin 9.80E-02 -9.12E-02 -3.86E-01
Rectal cancer 2B92 Rectal colon tissue 3.04E-01 -8.92E-02 -4.64E-01
Renal cancer 2C90-2C91 Kidney 9.50E-01 5.15E-03 2.09E-02
Retinoblastoma 2D02.2 Uvea 2.34E-02 -8.85E-02 -7.08E-01
Rheumatoid arthritis FA20 Synovial tissue 2.50E-02 -1.68E-01 -1.38E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.44E-01 -4.06E-02 -3.10E-01
Schizophrenia 6A20 Prefrontal cortex 6.53E-02 4.69E-02 2.33E-01
Schizophrenia 6A20 Superior temporal cortex 2.28E-01 6.02E-03 5.83E-02
Scleroderma 4A42.Z Whole blood 4.03E-02 9.33E-02 8.49E-01
Seizure 8A60-8A6Z Whole blood 8.70E-01 4.01E-02 2.37E-01
Sensitive skin EK0Z Skin 3.40E-01 2.94E-02 2.75E-01
Sepsis with septic shock 1G41 Whole blood 4.91E-03 2.31E-02 1.33E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.17E-02 2.94E-01 1.01E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.22E-01 5.46E-02 2.83E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.16E-01 4.11E-02 1.36E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.62E-02 -1.54E-01 -2.43E+00
Skin cancer 2C30-2C3Z Skin 2.05E-05 -8.88E-02 -4.01E-01
Thrombocythemia 3B63 Whole blood 6.53E-04 7.85E-02 8.01E-01
Thrombocytopenia 3B64 Whole blood 6.06E-01 -9.05E-02 -2.28E-01
Thyroid cancer 2D10 Thyroid 4.42E-02 4.54E-02 2.51E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.39E-07 -2.62E-01 -2.34E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.93E-01 4.33E-02 4.20E-01
Type 2 diabetes 5A11 Liver tissue 2.26E-01 -4.62E-02 -5.81E-01
Ureter cancer 2C92 Urothelium 9.60E-01 1.42E-02 6.98E-02
Uterine cancer 2C78 Endometrium tissue 6.89E-01 2.58E-02 1.20E-01
Vitiligo ED63.0 Skin 9.82E-01 -7.61E-03 -3.66E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The pharmacology of the pineal gland. Annu Rev Pharmacol Toxicol. 1976;16:33-51.