Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEIHSMD)

DME Name Butyrylcholine esterase (BCHE)
Synonyms Acylcholine acylhydrolase; Choline esterase II; Cholinesterase; Pseudocholinesterase; BCHE; CHE1
Gene Name BCHE
UniProt ID
CHLE_HUMAN
INTEDE ID
DME0069
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
590
EC Number EC: 3.1.1.8
Hydrolases
Ester bond hydrolase
Carboxylic ester hydrolase
EC: 3.1.1.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIP
YAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDC
LYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG
FLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPG
SHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI
LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVY
GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV
VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLER
RDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMT
KLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV
GL
Function This enzyme has a broad substrate specificity. It contributes to the inactivation of the neurotransmitter acetylcholine and it can degrade neurotoxic organophosphate esters.
Reactome Pathway
Synthesis of PC (R-HSA-1483191 )
Synthesis, secretion, and deacylation of Ghrelin (R-HSA-422085 )
Neurotransmitter clearance (R-HSA-112311 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cocaine DMSOX7I Anaesthesia 9A78.6 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.50E-01 -7.96E-03 -6.64E-02
Alopecia ED70 Skin from scalp 1.36E-04 3.76E-01 8.42E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.91E-02 -8.67E-02 -1.38E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.84E-01 -3.31E-02 -2.67E-01
Aortic stenosis BB70 Calcified aortic valve 9.86E-01 1.28E-01 3.60E-01
Apnea 7A40 Hyperplastic tonsil 2.31E-02 -4.71E-01 -9.25E-01
Arthropathy FA00-FA5Z Peripheral blood 2.22E-01 2.98E-02 3.34E-01
Asthma CA23 Nasal and bronchial airway 4.67E-01 -8.07E-03 -5.18E-02
Atopic dermatitis EA80 Skin 2.62E-11 -9.95E-01 -2.74E+00
Autism 6A02 Whole blood 6.05E-01 -2.27E-02 -1.59E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.38E-01 4.57E-02 5.74E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.81E-01 1.06E-01 9.25E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.26E-07 -3.66E-01 -6.48E-01
Batten disease 5C56.1 Whole blood 2.03E-01 1.38E-01 2.09E+00
Behcet's disease 4A62 Peripheral blood 3.46E-01 0.00E+00 0.00E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.05E-01 6.73E-02 1.60E-01
Bladder cancer 2C94 Bladder tissue 2.98E-04 -2.61E+00 -2.81E+00
Breast cancer 2C60-2C6Z Breast tissue 2.63E-56 -2.51E+00 -1.61E+00
Cardioembolic stroke 8B11.20 Whole blood 3.87E-02 7.24E-02 5.54E-01
Cervical cancer 2C77 Cervical tissue 1.26E-01 -6.67E-01 -5.54E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.75E-01 2.74E-02 2.46E-01
Chronic hepatitis C 1E51.1 Whole blood 8.73E-01 0.00E+00 0.00E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 3.49E-02 -4.39E-01 -5.56E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.59E-01 -7.63E-03 -1.79E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.84E-01 4.17E-02 5.13E-01
Colon cancer 2B90 Colon tissue 1.17E-18 -1.12E+00 -9.32E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.06E-01 -1.02E-01 -3.02E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.13E-01 -8.28E-03 -5.36E-02
Endometriosis GA10 Endometrium tissue 2.60E-01 -3.16E-01 -3.41E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.34E-01 -8.11E-02 -7.77E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.56E-01 -3.86E-02 -2.89E-01
Gastric cancer 2B72 Gastric tissue 8.44E-01 2.12E-01 8.96E-02
Glioblastopma 2A00.00 Nervous tissue 4.11E-99 2.55E+00 2.62E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.27E-01 1.61E+00 6.74E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.06E-02 2.29E+00 1.18E+00
Head and neck cancer 2D42 Head and neck tissue 7.82E-08 1.90E-01 5.35E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.31E-01 -2.16E-01 -3.83E-01
Huntington's disease 8A01.10 Whole blood 5.02E-01 -4.79E-02 -5.56E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.15E-03 1.47E+00 2.93E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.83E-01 5.04E-02 1.14E+00
Influenza 1E30 Whole blood 1.36E-01 5.55E-02 5.62E-01
Interstitial cystitis GC00.3 Bladder tissue 2.31E-02 -9.53E-01 -1.73E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.86E-08 -3.70E+00 -3.34E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.22E-02 -1.60E-01 -2.43E-01
Ischemic stroke 8B11 Peripheral blood 8.70E-02 8.26E-02 6.45E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.69E-02 6.15E-02 2.92E-01
Lateral sclerosis 8B60.4 Skin 7.85E-01 -1.13E-01 -2.39E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.11E-01 -4.46E-01 -1.13E+00
Liver cancer 2C12.0 Liver tissue 9.64E-41 -2.52E+00 -3.33E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.01E-03 -4.05E+00 -5.60E+00
Lung cancer 2C25 Lung tissue 1.03E-90 -2.85E+00 -2.84E+00
Lupus erythematosus 4A40 Whole blood 1.37E-01 -3.95E-02 -1.41E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.72E-01 3.28E-02 7.63E-02
Major depressive disorder 6A70-6A7Z Whole blood 5.30E-03 6.74E-02 3.80E-01
Melanoma 2C30 Skin 3.41E-02 1.04E+00 6.98E-01
Multiple myeloma 2A83.1 Peripheral blood 1.22E-01 4.21E-02 3.02E-01
Multiple myeloma 2A83.1 Bone marrow 4.51E-15 4.20E-02 3.19E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.99E-01 -9.17E-02 -5.10E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.75E-07 1.77E-02 1.38E-01
Myelofibrosis 2A20.2 Whole blood 1.68E-01 6.39E-02 5.06E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.91E-02 1.12E-01 2.78E-01
Myopathy 8C70.6 Muscle tissue 9.36E-01 -1.47E-02 -2.11E-02
Neonatal sepsis KA60 Whole blood 1.14E-01 -4.79E-02 -2.93E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.87E-05 2.04E+00 2.40E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.26E-02 1.40E+00 1.97E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.26E-03 -1.38E+00 -2.59E+00
Olive pollen allergy CA08.00 Peripheral blood 8.78E-01 1.67E-02 1.66E-01
Oral cancer 2B6E Oral tissue 3.14E-02 4.83E-02 7.98E-02
Osteoarthritis FA00-FA0Z Synovial tissue 8.38E-01 -1.75E-01 -1.84E-01
Osteoporosis FB83.1 Bone marrow 4.31E-01 1.12E-01 7.15E-01
Ovarian cancer 2C73 Ovarian tissue 3.33E-01 -1.16E+00 -6.31E-01
Pancreatic cancer 2C10 Pancreas 2.05E-01 -8.07E-01 -5.14E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.05E-01 -6.21E-02 -6.30E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.52E-01 5.56E-03 3.85E-02
Pituitary cancer 2D12 Pituitary tissue 4.80E-01 -6.08E-01 -5.22E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.88E-01 -8.23E-01 -5.93E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.75E-01 8.52E-02 2.16E-01
Polycythemia vera 2A20.4 Whole blood 2.52E-03 8.35E-02 7.01E-01
Pompe disease 5C51.3 Biceps muscle 8.29E-02 4.05E-01 1.53E+00
Preterm birth KA21.4Z Myometrium 8.97E-01 1.13E-01 1.03E-01
Prostate cancer 2C82 Prostate 1.81E-02 -8.92E-01 -6.68E-01
Psoriasis EA90 Skin 6.58E-15 -9.04E-01 -1.33E+00
Rectal cancer 2B92 Rectal colon tissue 9.45E-03 -3.41E+00 -2.25E+00
Renal cancer 2C90-2C91 Kidney 5.98E-01 2.39E-01 1.50E-01
Retinoblastoma 2D02.2 Uvea 5.15E-05 -4.19E+00 -9.10E+00
Rheumatoid arthritis FA20 Synovial tissue 3.71E-01 -4.65E-01 -5.08E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.33E-01 1.27E-02 1.10E-01
Schizophrenia 6A20 Prefrontal cortex 4.67E-02 -6.32E-01 -3.98E-01
Schizophrenia 6A20 Superior temporal cortex 8.23E-01 -2.30E-02 -8.60E-02
Scleroderma 4A42.Z Whole blood 2.97E-04 1.56E-01 1.60E+00
Seizure 8A60-8A6Z Whole blood 5.90E-01 -2.72E-02 -1.54E-01
Sensitive skin EK0Z Skin 5.95E-01 2.56E-01 8.61E-01
Sepsis with septic shock 1G41 Whole blood 6.85E-02 -7.71E-03 -5.14E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.40E-02 1.18E-01 4.96E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.18E-01 1.80E-02 9.25E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 7.37E-01 -3.92E-01 -3.42E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.04E-02 2.43E-01 5.95E+00
Skin cancer 2C30-2C3Z Skin 3.33E-01 2.80E-01 3.61E-01
Thrombocythemia 3B63 Whole blood 7.95E-02 5.83E-02 4.49E-01
Thrombocytopenia 3B64 Whole blood 4.12E-01 0.00E+00 0.00E+00
Thyroid cancer 2D10 Thyroid 2.52E-09 9.73E-02 1.42E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.07E-06 2.20E+00 2.61E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.35E-02 5.79E-01 2.45E+00
Type 2 diabetes 5A11 Liver tissue 1.43E-01 3.40E-01 1.30E+00
Ureter cancer 2C92 Urothelium 2.23E-01 8.34E-02 3.35E-01
Uterine cancer 2C78 Endometrium tissue 1.51E-02 -4.32E-01 -2.63E-01
Vitiligo ED63.0 Skin 3.76E-01 -5.35E-02 -1.96E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name HUMAN cholinesterase (BCHE) DTT Info

References

1 An albumin-butyrylcholinesterase for cocaine toxicity and addiction: catalytic and pharmacokinetic properties. Chem Biol Interact. 2008 Sep 25;175(1-3):83-7.