Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEJADS9)
DME Name | Aminoglycoside N-acetyltransferase (aacC2) | ||||
---|---|---|---|---|---|
Synonyms | Aminoglycoside N(6')-acetyltransferase type 1; Aminoglycoside resistance protein; AAC(6')-Ih | ||||
Gene Name | aacC2 | ||||
UniProt ID | |||||
INTEDE ID | |||||
3D Structure | |||||
Gene ID | |||||
EC Number | EC: 2.3.1.82 | ||||
Lineage | Species: Acinetobacter baumannii | ||||
Tissue Distribution | Primarily distributed in human lung. | ||||
Sequence |
MNIMPISESQLSDWLALRCLLWPDHEDVHLQEMRQLITQAHRLQLLAYTDTQQAIAMLEA
SIRYEYVNGTQTSPVAFLEGIFVLPEYRRSGIATGLVQQVEIWAKQFACTEFASDAALDN QISHAMHQALGFHETERVVYFKKNIG |
||||
Function |
This enzyme catalyzes the transfer of an acetyl group from acetyl-CoA to the 6'-amino group of aminoglycoside molecules conferring resistance to antibiotics containing the purpurosamine ring including amikacin, kanamycin, tobramycin and netilmicin.
|
||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
3 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||