General Information of Drug-Metabolizing Enzyme (DME) (ID: DEJVDAT)

DME Name Sepiapterin reductase (SPR)
Synonyms L-threo-7,8-dihydrobiopterin forming sepiapterin reductase; MDSPR; SPR
Gene Name SPR
UniProt ID
SPRE_HUMAN
INTEDE ID
DME0570
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
6697
EC Number EC: 1.1.1.153
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.153
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSG
LRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQV
NNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDML
FQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQK
LLSLLEKDEFKSGAHVDFYDK
Function This enzyme catalyzes the final one or two reductions in tetra- hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.
KEGG Pathway
Folate biosynthesis (hsa00790 )
Metabolic pathways (hsa01100 )
Reactome Pathway
eNOS activation (R-HSA-203615 )
Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation (R-HSA-1474151 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Menadione DMSJDTY Vitamin K deficiency 5B59 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,2-NAPHTHOQUINONE DMYXELH Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.42E-05 -1.41E-01 -5.55E-01
Alopecia ED70 Skin from scalp 1.19E-01 2.15E-02 6.18E-02
Alzheimer's disease 8A20 Entorhinal cortex 3.95E-07 1.69E-01 6.65E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.31E-01 2.25E-01 8.68E-01
Aortic stenosis BB70 Calcified aortic valve 8.40E-01 -1.67E-02 -5.23E-02
Apnea 7A40 Hyperplastic tonsil 7.67E-01 6.82E-02 6.13E-01
Arthropathy FA00-FA5Z Peripheral blood 9.11E-01 2.86E-02 1.36E-01
Asthma CA23 Nasal and bronchial airway 8.76E-01 -2.24E-02 -3.55E-02
Atopic dermatitis EA80 Skin 1.81E-17 4.81E-01 4.19E+00
Autism 6A02 Whole blood 2.71E-01 -6.15E-02 -2.40E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.60E-02 -2.45E-01 -1.83E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.24E-01 3.71E-02 3.49E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.63E-02 1.03E-01 4.17E-01
Batten disease 5C56.1 Whole blood 3.21E-01 7.13E-02 4.69E-01
Behcet's disease 4A62 Peripheral blood 3.53E-01 5.72E-02 1.80E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.40E-02 9.05E-02 6.65E-01
Bladder cancer 2C94 Bladder tissue 4.79E-01 -8.55E-02 -3.92E-01
Breast cancer 2C60-2C6Z Breast tissue 2.72E-41 3.11E-01 1.10E+00
Cardioembolic stroke 8B11.20 Whole blood 1.58E-01 9.31E-04 2.89E-03
Cervical cancer 2C77 Cervical tissue 3.36E-01 -5.00E-02 -1.95E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.08E-01 8.59E-02 3.12E-01
Chronic hepatitis C 1E51.1 Whole blood 4.17E-01 3.66E-02 2.64E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.20E-01 -1.99E-02 -8.03E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.81E-01 3.50E-02 1.14E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.30E-01 2.04E-02 6.42E-02
Colon cancer 2B90 Colon tissue 1.24E-20 -3.10E-01 -1.07E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.73E-01 -7.30E-03 -1.33E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.07E-01 -8.04E-02 -2.70E-01
Endometriosis GA10 Endometrium tissue 1.44E-01 -1.62E-01 -3.60E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.58E-01 -7.64E-02 -4.74E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.65E-01 -3.75E-02 -1.79E-01
Gastric cancer 2B72 Gastric tissue 4.75E-01 4.18E-01 9.88E-01
Glioblastopma 2A00.00 Nervous tissue 6.17E-01 -3.10E-02 -8.16E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.40E-01 -1.28E+00 -9.73E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.27E-04 9.12E-01 1.67E+00
Head and neck cancer 2D42 Head and neck tissue 2.89E-02 -9.76E-02 -2.56E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.15E-01 -1.00E-01 -1.54E-01
Huntington's disease 8A01.10 Whole blood 2.97E-01 3.07E-02 3.62E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.27E-02 3.11E-01 1.78E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.30E-01 6.58E-02 4.62E-01
Influenza 1E30 Whole blood 3.85E-03 -5.09E-01 -4.28E+00
Interstitial cystitis GC00.3 Bladder tissue 7.95E-03 -4.49E-01 -2.10E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.02E-01 5.83E-02 1.15E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.01E-02 -8.27E-01 -1.08E+00
Ischemic stroke 8B11 Peripheral blood 8.93E-01 3.50E-03 2.18E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.48E-04 -1.44E-01 -3.72E-01
Lateral sclerosis 8B60.4 Skin 1.06E-01 1.01E-01 7.85E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.87E-01 5.08E-03 8.72E-03
Liver cancer 2C12.0 Liver tissue 8.28E-01 2.43E-02 7.01E-02
Liver failure DB99.7-DB99.8 Liver tissue 5.52E-04 -1.20E+00 -2.40E+00
Lung cancer 2C25 Lung tissue 1.52E-51 3.94E-01 1.53E+00
Lupus erythematosus 4A40 Whole blood 1.85E-03 -2.98E-01 -3.58E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.02E-01 3.49E-02 2.93E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.83E-01 1.81E-02 5.44E-02
Melanoma 2C30 Skin 2.04E-03 4.05E-01 5.62E-01
Multiple myeloma 2A83.1 Peripheral blood 7.02E-01 -1.56E-01 -5.59E-01
Multiple myeloma 2A83.1 Bone marrow 5.71E-06 8.31E-01 3.99E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.29E-01 7.86E-02 1.40E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.32E-07 2.27E-01 9.73E-01
Myelofibrosis 2A20.2 Whole blood 7.79E-03 -7.59E-02 -5.87E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.86E-02 5.45E-01 5.10E-01
Myopathy 8C70.6 Muscle tissue 1.90E-01 -4.87E-02 -2.05E-01
Neonatal sepsis KA60 Whole blood 7.42E-01 -5.64E-02 -1.65E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.52E-01 -1.73E-01 -5.21E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 3.79E-01 -1.19E-01 -4.27E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.09E-02 2.37E-01 1.34E+00
Olive pollen allergy CA08.00 Peripheral blood 6.15E-02 4.58E-01 1.50E+00
Oral cancer 2B6E Oral tissue 7.99E-01 6.37E-02 1.23E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.40E-01 1.37E-01 2.33E-01
Osteoporosis FB83.1 Bone marrow 1.48E-04 4.66E-01 4.48E+00
Ovarian cancer 2C73 Ovarian tissue 1.66E-02 7.09E-01 1.21E+00
Pancreatic cancer 2C10 Pancreas 9.62E-01 -2.21E-01 -3.36E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.59E-02 3.51E-01 9.51E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.12E-01 7.14E-02 5.78E-01
Pituitary cancer 2D12 Pituitary tissue 1.74E-01 2.45E-01 5.82E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.55E-01 -7.48E-02 -1.44E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.03E-01 -1.49E-01 -7.70E-01
Polycythemia vera 2A20.4 Whole blood 1.22E-01 -6.74E-02 -4.91E-01
Pompe disease 5C51.3 Biceps muscle 3.35E-01 2.35E-01 4.31E-01
Preterm birth KA21.4Z Myometrium 4.91E-01 -2.22E-02 -1.88E-01
Prostate cancer 2C82 Prostate 8.42E-01 -3.13E-02 -4.94E-02
Psoriasis EA90 Skin 1.06E-08 -1.79E-01 -6.12E-01
Rectal cancer 2B92 Rectal colon tissue 1.95E-08 -5.13E-01 -5.65E+00
Renal cancer 2C90-2C91 Kidney 6.78E-01 -3.25E-01 -4.86E-01
Retinoblastoma 2D02.2 Uvea 2.64E-14 1.82E+00 7.00E+00
Rheumatoid arthritis FA20 Synovial tissue 1.13E-03 7.66E-01 2.48E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.41E-01 -5.11E-02 -3.18E-01
Schizophrenia 6A20 Prefrontal cortex 8.58E-01 -4.10E-02 -1.06E-01
Schizophrenia 6A20 Superior temporal cortex 8.41E-01 9.66E-03 7.08E-02
Scleroderma 4A42.Z Whole blood 6.10E-04 4.87E-01 1.94E+00
Seizure 8A60-8A6Z Whole blood 2.97E-02 -2.83E-01 -1.09E+00
Sensitive skin EK0Z Skin 4.33E-01 -8.87E-02 -4.16E-01
Sepsis with septic shock 1G41 Whole blood 3.46E-05 5.46E-02 1.62E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.79E-01 -9.97E-02 -3.35E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.20E-01 -3.18E-02 -2.47E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.86E-01 -8.43E-02 -3.26E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.88E-02 -3.70E-01 -1.22E+00
Skin cancer 2C30-2C3Z Skin 1.85E-17 5.39E-01 1.25E+00
Thrombocythemia 3B63 Whole blood 3.07E-02 -8.94E-02 -6.78E-01
Thrombocytopenia 3B64 Whole blood 6.68E-01 3.34E-01 4.61E-01
Thyroid cancer 2D10 Thyroid 2.51E-12 -4.39E-01 -1.56E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.00E-07 -7.30E-01 -3.14E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.34E-01 2.83E-01 1.92E+00
Type 2 diabetes 5A11 Liver tissue 1.15E-01 -1.50E-01 -5.65E-01
Ureter cancer 2C92 Urothelium 9.27E-01 7.00E-02 2.82E-01
Uterine cancer 2C78 Endometrium tissue 5.46E-01 5.43E-02 1.06E-01
Vitiligo ED63.0 Skin 3.23E-01 -3.07E-01 -9.93E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Sepiapterin reductase mediates chemical redox cycling in lung epithelial cells. J Biol Chem. 2013 Jun 28;288(26):19221-37.