Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEMF740)

DME Name Cytochrome P450 4B1 (CYP4B1)
Synonyms Cytochrome P450 family 4 subfamily B member 1; CYP4B1; CYPIVB1; Cytochrome P450-HP
Gene Name CYP4B1
UniProt ID
CP4B1_HUMAN
INTEDE ID
DME0010
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1580
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALE
IQETGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQ
WIGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDI
FCDVGHMALNTLMKCTFGRGDTGLGHRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWLT
PHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKL
SDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDL
GKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWP
DPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDP
SRLPIKMPQLVLRSKNGFHLHLKPLGPGSGK
Function This enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Reactome Pathway
Fatty acids (R-HSA-211935 )
Miscellaneous substrates (R-HSA-211958 )
Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 )
Eicosanoids (R-HSA-211979 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Midazolam DMXOELT Agitation 6A70.3 Approved [1]
Progesterone DMUY35B Amenorrhea GA20.0 Approved [2]
Testosterone cypionate DMC1TEV N. A. N. A. Approved [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.01E-03 3.26E-02 1.83E-01
Alopecia ED70 Skin from scalp 8.88E-02 2.55E-01 3.43E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.90E-02 5.64E-02 3.35E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.17E-01 3.92E-02 3.46E-01
Aortic stenosis BB70 Calcified aortic valve 5.69E-03 -5.58E-01 -4.97E-01
Apnea 7A40 Hyperplastic tonsil 2.56E-02 9.76E-01 1.30E+00
Arthropathy FA00-FA5Z Peripheral blood 1.80E-01 5.35E-03 5.96E-02
Asthma CA23 Nasal and bronchial airway 1.23E-04 -5.41E-01 -6.25E-01
Atopic dermatitis EA80 Skin 5.37E-01 -1.60E-01 -5.55E-01
Autism 6A02 Whole blood 6.72E-01 -1.65E-02 -1.05E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.04E-02 -7.36E-02 -8.26E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.40E-01 -6.67E-02 -5.95E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.65E-01 8.69E-02 1.14E-01
Batten disease 5C56.1 Whole blood 2.84E-01 1.79E-02 3.23E-01
Behcet's disease 4A62 Peripheral blood 5.00E-01 1.27E-01 7.33E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.03E-01 -7.11E-02 -3.62E-01
Bladder cancer 2C94 Bladder tissue 3.38E-03 -2.54E+00 -1.95E+00
Breast cancer 2C60-2C6Z Breast tissue 3.53E-09 -7.50E-01 -7.20E-01
Cardioembolic stroke 8B11.20 Whole blood 7.35E-04 1.44E-01 8.24E-01
Cervical cancer 2C77 Cervical tissue 1.61E-01 2.23E-01 2.49E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.92E-01 -4.03E-02 -3.09E-01
Chronic hepatitis C 1E51.1 Whole blood 7.93E-01 3.01E-02 1.53E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.70E-02 -1.86E-01 -3.70E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.10E-03 -3.06E-01 -5.09E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.28E-02 -1.80E+00 -1.35E+00
Colon cancer 2B90 Colon tissue 9.06E-01 -4.60E-03 -1.37E-02
Coronary artery disease BA80-BA8Z Peripheral blood 2.60E-01 -8.59E-02 -5.23E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.57E-01 -1.31E-02 -9.27E-02
Endometriosis GA10 Endometrium tissue 4.87E-01 -1.04E-01 -1.01E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.59E-01 -1.02E-01 -6.23E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.80E-02 -1.96E-01 -1.10E+00
Gastric cancer 2B72 Gastric tissue 3.31E-01 -3.21E-01 -1.06E+00
Glioblastopma 2A00.00 Nervous tissue 8.72E-03 -1.13E-01 -2.48E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.53E-01 -7.27E-02 -2.81E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.67E-03 -2.63E-01 -1.20E+00
Head and neck cancer 2D42 Head and neck tissue 6.73E-29 -3.89E+00 -1.53E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.75E-01 -7.85E-02 -3.55E-01
Huntington's disease 8A01.10 Whole blood 3.41E-01 3.83E-02 3.49E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.61E-01 -4.47E-02 -8.12E-02
Immunodeficiency 4A00-4A20 Peripheral blood 1.98E-01 -4.62E-02 -3.15E-01
Influenza 1E30 Whole blood 1.97E-01 8.55E-02 7.37E-01
Interstitial cystitis GC00.3 Bladder tissue 1.09E-03 -2.64E+00 -4.60E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.69E-05 -2.32E+00 -3.12E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.45E-01 2.24E-02 1.03E-01
Ischemic stroke 8B11 Peripheral blood 5.90E-01 6.60E-02 5.73E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.74E-03 3.65E-02 2.24E-01
Lateral sclerosis 8B60.4 Skin 8.65E-01 -1.61E-02 -1.13E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.23E-01 1.36E-01 8.83E-01
Liver cancer 2C12.0 Liver tissue 1.77E-05 -1.62E-01 -7.61E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.60E-02 -1.70E-01 -7.94E-01
Lung cancer 2C25 Lung tissue 1.76E-176 -3.62E+00 -4.53E+00
Lupus erythematosus 4A40 Whole blood 2.21E-02 -9.73E-02 -2.18E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.08E-01 -5.66E-03 -3.75E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.31E-01 -2.90E-02 -1.42E-01
Melanoma 2C30 Skin 6.63E-04 -1.60E+00 -9.12E-01
Multiple myeloma 2A83.1 Peripheral blood 4.51E-01 -3.21E-03 -2.74E-02
Multiple myeloma 2A83.1 Bone marrow 4.29E-01 -3.21E-03 -4.50E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.20E-01 -5.33E-02 -6.75E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.15E-01 4.47E-02 4.39E-01
Myelofibrosis 2A20.2 Whole blood 5.43E-01 -2.54E-02 -2.03E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.04E-01 1.05E-01 2.28E-01
Myopathy 8C70.6 Muscle tissue 1.18E-03 -7.46E-01 -1.65E+00
Neonatal sepsis KA60 Whole blood 9.46E-01 2.79E-02 1.62E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.87E-05 -8.41E-01 -2.75E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.14E-01 -5.12E-02 -5.21E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.11E-01 -1.75E-01 -2.27E-01
Olive pollen allergy CA08.00 Peripheral blood 5.37E-01 8.09E-02 8.09E-01
Oral cancer 2B6E Oral tissue 4.26E-06 -1.36E+00 -1.28E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.36E-01 -1.10E-01 -1.54E-01
Osteoporosis FB83.1 Bone marrow 2.06E-02 3.28E-01 2.92E+00
Ovarian cancer 2C73 Ovarian tissue 1.77E-03 2.04E+00 1.92E+00
Pancreatic cancer 2C10 Pancreas 5.20E-02 -3.65E-01 -4.15E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.89E-01 -5.30E-02 -4.75E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.71E-01 5.89E-03 6.78E-02
Pituitary cancer 2D12 Pituitary tissue 1.89E-06 -2.40E+00 -2.78E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.46E-06 -2.52E+00 -2.85E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.27E-01 -9.36E-02 -3.48E-01
Polycythemia vera 2A20.4 Whole blood 3.50E-01 -4.99E-02 -4.02E-01
Pompe disease 5C51.3 Biceps muscle 1.64E-01 -2.44E-01 -2.89E-01
Preterm birth KA21.4Z Myometrium 1.66E-02 2.68E+00 1.85E+00
Prostate cancer 2C82 Prostate 4.17E-09 -2.37E+00 -2.14E+00
Psoriasis EA90 Skin 8.37E-16 -1.17E+00 -1.30E+00
Rectal cancer 2B92 Rectal colon tissue 3.99E-01 -9.50E-02 -5.29E-01
Renal cancer 2C90-2C91 Kidney 5.94E-02 -3.64E-01 -8.43E-01
Retinoblastoma 2D02.2 Uvea 1.72E-03 -2.64E-01 -2.28E+00
Rheumatoid arthritis FA20 Synovial tissue 1.22E-01 -2.80E-01 -3.98E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.10E-01 -2.06E-02 -3.09E-02
Schizophrenia 6A20 Prefrontal cortex 4.23E-01 -2.83E-02 -1.07E-01
Schizophrenia 6A20 Superior temporal cortex 4.58E-01 -2.49E-02 -2.83E-01
Scleroderma 4A42.Z Whole blood 6.43E-02 -7.26E-02 -1.28E+00
Seizure 8A60-8A6Z Whole blood 7.32E-01 2.65E-02 1.25E-01
Sensitive skin EK0Z Skin 6.29E-01 -4.70E-01 -5.06E-01
Sepsis with septic shock 1G41 Whole blood 2.85E-01 -3.67E-02 -2.00E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.82E-01 2.74E-01 1.12E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.56E-01 4.05E-02 1.82E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.63E-01 1.61E-02 1.45E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.86E-01 -1.89E-01 -4.08E-01
Skin cancer 2C30-2C3Z Skin 1.34E-124 -2.92E+00 -3.13E+00
Thrombocythemia 3B63 Whole blood 1.41E-01 -4.62E-02 -3.40E-01
Thrombocytopenia 3B64 Whole blood 3.45E-01 4.27E-01 8.50E-01
Thyroid cancer 2D10 Thyroid 9.22E-01 -1.17E-02 -2.01E-02
Tibial muscular dystrophy 8C75 Muscle tissue 7.60E-09 -2.03E+00 -3.47E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.83E-01 9.96E-02 8.94E-01
Type 2 diabetes 5A11 Liver tissue 8.12E-01 -3.99E-02 -3.23E-01
Ureter cancer 2C92 Urothelium 4.45E-01 2.00E-02 4.23E-02
Uterine cancer 2C78 Endometrium tissue 6.27E-03 -5.51E-01 -3.60E-01
Vitiligo ED63.0 Skin 6.01E-02 -4.03E-01 -5.75E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
2 Steroid hormone hydroxylase specificities of eleven cDNA-expressed human cytochrome P450s. Arch Biochem Biophys. 1991 Oct;290(1):160-6.