Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DENZ6B1)

DME Name UDP-glucuronosyltransferase 2B15 (UGT2B15)
Synonyms UDP-glucuronosyltransferase family 2 member B15; UDP-glucuronosyltransferase 2B8; HLUG4; UDPGT 2B15; UDPGT 2B8; UDPGTh-3; UGT2B15; UGT2B8
Gene Name UGT2B15
UniProt ID
UDB15_HUMAN
INTEDE ID
DME0049
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7366
EC Number EC: 2.4.1.17
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.17
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSA
STLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEY
YDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYT
FEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEV
LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
GENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT
MSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVA
AHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD
Function
This enzyme displays activity toward several classes of xenobiotic substrates, including simple phenolic compounds, 7- hydroxylated coumarins, flavonoids, anthraquinones, and certain drugs and their hydroxylated metabolites. And it also catalyzes the glucuronidation of endogenous estrogens and androgens.
KEGG Pathway
Ascorbate and aldarate metabolism (hsa00053 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pentose and glucuronate interconversions (hsa00040 )
Porphyrin and chlorophyll metabolism (hsa00860 )
Retinol metabolism (hsa00830 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Glucuronidation (R-HSA-156588 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acetaminophen DMUIE76 Pain MG30-MG3Z Approved [1]
Ezetimibe DM7A8TW Hypercholesterolaemia 5C80.0 Approved [2]
Lorazepam DM84ZXF Anxiety disorder 6B00-6B0Z Approved [3]
3 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
BRN-1980310 DMOTU4P Discovery agent N.A. Investigative [4]
Hydroxybenzo(a)pyrene DM9H5EN Discovery agent N.A. Investigative [4]
Hydroxybenzo[a]pyrene DMFSKYE Discovery agent N.A. Investigative [4]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.78E-02 -2.72E-02 -1.65E-01
Alopecia ED70 Skin from scalp 2.61E-02 7.09E-02 5.54E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.42E-01 1.07E-02 7.06E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.56E-01 -3.01E-02 -2.51E-01
Aortic stenosis BB70 Calcified aortic valve 9.96E-01 -3.85E-02 -7.52E-02
Apnea 7A40 Hyperplastic tonsil 8.40E-01 -9.59E-02 -3.66E-01
Arthropathy FA00-FA5Z Peripheral blood 2.13E-01 5.17E-02 4.05E-01
Asthma CA23 Nasal and bronchial airway 6.40E-01 2.79E-03 1.42E-02
Atopic dermatitis EA80 Skin 4.77E-01 2.23E-02 2.15E-01
Autism 6A02 Whole blood 5.90E-01 -4.05E-02 -2.04E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.88E-01 1.66E-02 1.14E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.61E-01 6.90E-02 4.13E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.73E-03 5.52E-02 2.57E-01
Batten disease 5C56.1 Whole blood 5.20E-02 -5.79E-03 -4.44E-02
Behcet's disease 4A62 Peripheral blood 8.22E-01 6.19E-02 3.23E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.09E-01 -2.47E-02 -2.68E-01
Bladder cancer 2C94 Bladder tissue 1.37E-04 4.20E-01 1.87E+00
Breast cancer 2C60-2C6Z Breast tissue 2.53E-04 -2.73E-01 -3.38E-01
Cardioembolic stroke 8B11.20 Whole blood 2.70E-01 2.36E-02 1.59E-01
Cervical cancer 2C77 Cervical tissue 3.36E-01 -5.37E-02 -2.65E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.97E-01 -2.86E-02 -1.33E-01
Chronic hepatitis C 1E51.1 Whole blood 1.41E-01 1.57E-01 1.01E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 5.78E-02 1.47E-01 9.48E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.55E-01 2.00E-03 1.32E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.37E-01 3.24E-04 2.61E-03
Colon cancer 2B90 Colon tissue 7.42E-01 -2.46E-01 -5.41E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.37E-02 1.29E-01 2.65E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.12E-01 7.76E-02 6.20E-01
Endometriosis GA10 Endometrium tissue 8.73E-01 4.69E-03 1.49E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.00E-02 9.84E-02 8.58E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.87E-01 -5.07E-03 -2.38E-02
Gastric cancer 2B72 Gastric tissue 2.97E-01 -2.42E+00 -1.29E+00
Glioblastopma 2A00.00 Nervous tissue 5.62E-01 -4.90E-02 -1.85E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.77E-01 1.53E-01 8.60E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.04E-02 -1.73E-01 -7.84E-01
Head and neck cancer 2D42 Head and neck tissue 2.45E-01 3.54E-02 1.89E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.41E-02 -7.14E-02 -2.77E-01
Huntington's disease 8A01.10 Whole blood 4.27E-01 6.28E-03 4.49E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.56E-01 -7.68E-02 -4.11E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.60E-01 2.23E-04 1.88E-03
Influenza 1E30 Whole blood 4.21E-01 1.32E-01 1.24E+00
Interstitial cystitis GC00.3 Bladder tissue 2.54E-01 -8.86E-02 -6.13E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.79E-01 5.15E-03 2.86E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.43E-01 -1.17E-01 -1.34E-01
Ischemic stroke 8B11 Peripheral blood 3.56E-02 1.23E-01 8.31E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.73E-03 8.11E-02 4.06E-01
Lateral sclerosis 8B60.4 Skin 2.55E-01 1.95E-02 4.09E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.47E-02 1.75E-01 1.34E+00
Liver cancer 2C12.0 Liver tissue 1.06E-28 -6.22E-01 -1.31E+00
Liver failure DB99.7-DB99.8 Liver tissue 5.11E-03 -2.00E+00 -2.96E+00
Lung cancer 2C25 Lung tissue 2.22E-26 1.14E-01 6.51E-01
Lupus erythematosus 4A40 Whole blood 7.02E-01 -3.32E-02 -1.17E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.18E-01 -3.41E-02 -3.63E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.34E-01 3.42E-02 1.24E-01
Melanoma 2C30 Skin 1.68E-01 -3.50E-02 -8.94E-02
Multiple myeloma 2A83.1 Peripheral blood 3.68E-02 9.89E-02 5.61E-01
Multiple myeloma 2A83.1 Bone marrow 4.47E-02 -1.19E-01 -6.63E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.18E-01 1.55E-01 1.10E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.33E-03 -9.17E-02 -7.35E-01
Myelofibrosis 2A20.2 Whole blood 2.07E-04 2.01E-01 1.73E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.02E-01 6.42E-02 1.74E-01
Myopathy 8C70.6 Muscle tissue 4.43E-01 -1.07E-01 -1.10E+00
Neonatal sepsis KA60 Whole blood 6.17E-01 6.45E-02 3.19E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.02E-05 -5.75E-01 -2.32E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.23E-01 -5.44E-02 -1.54E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.07E-01 8.49E-02 7.19E-01
Olive pollen allergy CA08.00 Peripheral blood 2.72E-01 5.26E-02 1.25E+00
Oral cancer 2B6E Oral tissue 5.29E-01 -2.33E-01 -5.49E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.26E-01 1.23E-02 5.07E-02
Osteoporosis FB83.1 Bone marrow 6.33E-01 -7.67E-03 -8.31E-02
Ovarian cancer 2C73 Ovarian tissue 5.33E-01 -2.39E-01 -8.68E-01
Pancreatic cancer 2C10 Pancreas 1.42E-01 -3.15E-01 -2.06E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.75E-01 9.00E-02 8.57E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.12E-01 -2.88E-02 -1.71E-01
Pituitary cancer 2D12 Pituitary tissue 2.49E-01 -8.68E-02 -4.48E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.87E-01 -1.15E-01 -8.18E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.41E-01 9.86E-02 3.67E-01
Polycythemia vera 2A20.4 Whole blood 2.01E-10 7.90E-02 8.86E-01
Pompe disease 5C51.3 Biceps muscle 9.71E-01 3.77E-02 2.53E-01
Preterm birth KA21.4Z Myometrium 3.69E-01 1.24E-01 1.20E+00
Prostate cancer 2C82 Prostate 8.84E-01 -2.21E-01 -6.67E-01
Psoriasis EA90 Skin 8.79E-07 -1.58E-01 -6.82E-01
Rectal cancer 2B92 Rectal colon tissue 9.88E-01 -1.89E-01 -4.49E-01
Renal cancer 2C90-2C91 Kidney 2.77E-02 -1.36E-01 -3.73E-01
Retinoblastoma 2D02.2 Uvea 4.32E-02 -4.16E-02 -3.86E-01
Rheumatoid arthritis FA20 Synovial tissue 2.04E-01 -1.01E-01 -4.36E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.71E-01 1.38E-02 1.01E-01
Schizophrenia 6A20 Prefrontal cortex 2.49E-01 2.03E-02 1.05E-01
Schizophrenia 6A20 Superior temporal cortex 9.61E-01 -2.50E-02 -2.43E-01
Scleroderma 4A42.Z Whole blood 5.93E-01 -2.47E-03 -2.52E-02
Seizure 8A60-8A6Z Whole blood 4.61E-01 -6.13E-02 -3.76E-01
Sensitive skin EK0Z Skin 9.83E-01 -1.31E-02 -1.30E-01
Sepsis with septic shock 1G41 Whole blood 8.13E-04 6.51E-02 3.22E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.31E-02 2.24E-01 1.04E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.05E-01 7.78E-02 6.35E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.31E-01 2.31E-02 2.29E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.72E-01 -8.56E-02 -5.78E-01
Skin cancer 2C30-2C3Z Skin 9.66E-01 -4.52E-02 -1.91E-01
Thrombocythemia 3B63 Whole blood 9.42E-04 1.76E-01 1.47E+00
Thrombocytopenia 3B64 Whole blood 6.04E-01 1.58E-01 9.26E-01
Thyroid cancer 2D10 Thyroid 1.94E-02 3.11E-02 1.96E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.89E-01 1.38E-02 1.60E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.79E-02 1.47E-01 1.81E+00
Type 2 diabetes 5A11 Liver tissue 4.96E-01 6.23E-02 2.06E-01
Ureter cancer 2C92 Urothelium 5.85E-01 2.81E-02 1.18E-01
Uterine cancer 2C78 Endometrium tissue 4.05E-01 7.84E-02 2.65E-01
Vitiligo ED63.0 Skin 8.24E-01 -2.64E-02 -1.92E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Characterization of niflumic acid as a selective inhibitor of human liver microsomal UDP-glucuronosyltransferase 1A9: application to the reaction phenotyping of acetaminophen glucuronidation. Drug Metab Dispos. 2011 Apr;39(4):644-52.
2 Ezetimibe: a review of its metabolism, pharmacokinetics and drug interactions. Clin Pharmacokinet. 2005;44(5):467-94.
3 Effect of the UGT2B15 genotype on the pharmacokinetics, pharmacodynamics, and drug interactions of intravenous lorazepam in healthy volunteers. Clin Pharmacol Ther. 2005 Jun;77(6):486-94.
4 Importance of UDP-glucuronosyltransferase 1A10 (UGT1A10) in the detoxification of polycyclic aromatic hydrocarbons: decreased glucuronidative activity of the UGT1A10139Lys isoform. Drug Metab Dispos. 2006 Jun;34(6):943-9.