Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEXHBCR)

DME Name S-methyl-5'-thioadenosine phosphorylase (MTAP)
Synonyms MTA phosphorylase; 5'-methylthioadenosine phosphorylase; MTAPase; MSAP; MTAP
Gene Name MTAP
UniProt ID
MTAP_HUMAN
INTEDE ID
DME0464
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4507
EC Number EC: 2.4.2.28
Transferase
Glycosyltransferases
Pentosyltransferase
EC: 2.4.2.28
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLAR
HGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMR
PQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSR
AESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTL
KENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Function
This enzyme catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. It is involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. And it is responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Additionally, it has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.
KEGG Pathway
Cysteine and methionine metabolism (hsa00270 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Methionine salvage pathway (R-HSA-1237112 )
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
METHYLTHIOADENOSINE DMC8J6F Multiple sclerosis 8A40 Terminated [2]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
METHYLTHIOADENOSINE Multiple sclerosis [8A40] Terminated Km = 0.005 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.10E-03 7.30E-02 3.48E-01
Alopecia ED70 Skin from scalp 2.24E-01 -4.93E-02 -1.49E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.11E-01 -3.06E-03 -2.36E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 6.27E-02 2.77E-01 1.30E+00
Aortic stenosis BB70 Calcified aortic valve 5.18E-01 -5.63E-02 -4.97E-01
Apnea 7A40 Hyperplastic tonsil 6.57E-01 -2.01E-01 -1.09E+00
Arthropathy FA00-FA5Z Peripheral blood 6.11E-01 3.27E-02 1.84E-01
Asthma CA23 Nasal and bronchial airway 2.89E-06 2.89E-01 7.17E-01
Atopic dermatitis EA80 Skin 6.31E-01 -3.42E-02 -1.55E-01
Autism 6A02 Whole blood 3.78E-01 -1.50E-01 -8.29E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.45E-01 -4.83E-02 -2.74E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.86E-01 -4.74E-02 -3.55E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.44E-05 -1.08E-01 -4.52E-01
Batten disease 5C56.1 Whole blood 2.80E-01 -5.89E-02 -2.96E-01
Behcet's disease 4A62 Peripheral blood 6.15E-01 -6.25E-02 -2.78E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.02E-01 3.44E-02 2.52E-01
Bladder cancer 2C94 Bladder tissue 1.44E-02 -4.88E-01 -1.71E+00
Breast cancer 2C60-2C6Z Breast tissue 5.58E-11 3.72E-02 1.78E-01
Cardioembolic stroke 8B11.20 Whole blood 7.14E-04 -2.63E-01 -9.10E-01
Cervical cancer 2C77 Cervical tissue 1.10E-02 2.30E-01 1.11E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.55E-01 1.04E-01 3.19E-01
Chronic hepatitis C 1E51.1 Whole blood 5.76E-01 -5.73E-02 -3.83E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.83E-01 -1.54E-01 -5.66E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.40E-07 -1.61E-01 -7.46E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.91E-02 1.06E-01 1.35E+00
Colon cancer 2B90 Colon tissue 3.53E-78 4.74E-01 2.10E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.78E-01 3.74E-03 3.61E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.59E-01 1.19E-01 7.41E-01
Endometriosis GA10 Endometrium tissue 2.72E-01 -1.51E-01 -3.36E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.88E-01 -4.23E-02 -2.18E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.60E-01 -1.37E-02 -8.35E-02
Gastric cancer 2B72 Gastric tissue 1.35E-02 4.51E-01 3.33E+00
Glioblastopma 2A00.00 Nervous tissue 1.25E-46 2.54E-01 1.02E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.90E-01 7.52E-02 3.18E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.51E-03 1.69E-01 1.04E+00
Head and neck cancer 2D42 Head and neck tissue 1.52E-14 3.95E-01 1.91E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.44E-01 -1.12E-01 -8.55E-01
Huntington's disease 8A01.10 Whole blood 5.86E-01 3.71E-02 3.01E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.34E-01 -1.09E-01 -3.39E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.52E-01 1.26E-01 7.68E-01
Influenza 1E30 Whole blood 1.06E-02 -6.46E-01 -3.70E+00
Interstitial cystitis GC00.3 Bladder tissue 1.91E-02 -5.55E-01 -1.83E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.57E-01 1.27E-02 5.91E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.23E-01 4.98E-02 2.83E-01
Ischemic stroke 8B11 Peripheral blood 9.58E-01 -6.62E-02 -2.61E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.15E-02 -9.61E-02 -3.16E-01
Lateral sclerosis 8B60.4 Skin 9.20E-02 2.52E-01 1.10E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.72E-01 1.85E-02 1.04E-01
Liver cancer 2C12.0 Liver tissue 2.09E-01 5.31E-02 1.79E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.11E-02 -1.63E-01 -1.13E+00
Lung cancer 2C25 Lung tissue 2.73E-28 2.29E-01 8.34E-01
Lupus erythematosus 4A40 Whole blood 9.31E-01 7.33E-02 1.72E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.68E-01 -1.12E-02 -7.93E-02
Major depressive disorder 6A70-6A7Z Whole blood 9.78E-01 3.72E-02 1.25E-01
Melanoma 2C30 Skin 9.01E-02 1.82E-01 4.28E-01
Multiple myeloma 2A83.1 Peripheral blood 2.72E-01 -2.55E-01 -6.40E-01
Multiple myeloma 2A83.1 Bone marrow 5.96E-01 -3.65E-02 -2.32E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.81E-01 -6.84E-02 -2.78E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.79E-01 7.06E-02 1.60E-01
Myelofibrosis 2A20.2 Whole blood 4.14E-03 -1.96E-01 -1.27E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.38E-03 -2.57E-01 -6.04E-01
Myopathy 8C70.6 Muscle tissue 5.77E-01 1.01E-01 6.63E-01
Neonatal sepsis KA60 Whole blood 1.55E-02 8.37E-02 3.72E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.61E-06 7.56E-01 2.99E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.77E-01 5.52E-02 5.51E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.79E-02 -1.15E-01 -1.01E+00
Olive pollen allergy CA08.00 Peripheral blood 9.37E-01 -6.57E-03 -5.22E-02
Oral cancer 2B6E Oral tissue 1.00E-05 2.67E-01 1.28E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.23E-01 5.84E-02 2.28E-01
Osteoporosis FB83.1 Bone marrow 3.42E-01 -1.09E-01 -2.06E-01
Ovarian cancer 2C73 Ovarian tissue 2.55E-03 3.07E-01 1.34E+00
Pancreatic cancer 2C10 Pancreas 2.56E-01 -1.47E-01 -1.07E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 7.43E-01 1.20E-02 1.42E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.80E-01 -7.86E-03 -5.99E-02
Pituitary cancer 2D12 Pituitary tissue 9.66E-01 5.39E-03 2.73E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.17E-01 -5.04E-03 -2.66E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.83E-01 -1.39E-02 -1.95E-01
Polycythemia vera 2A20.4 Whole blood 4.71E-08 -1.48E-01 -1.42E+00
Pompe disease 5C51.3 Biceps muscle 7.90E-02 -8.41E-02 -4.75E-01
Preterm birth KA21.4Z Myometrium 7.77E-01 -5.49E-03 -1.56E-02
Prostate cancer 2C82 Prostate 3.44E-06 5.80E-01 1.47E+00
Psoriasis EA90 Skin 3.40E-14 2.82E-01 9.41E-01
Rectal cancer 2B92 Rectal colon tissue 4.49E-04 3.11E-01 1.88E+00
Renal cancer 2C90-2C91 Kidney 3.17E-03 2.57E-01 1.25E+00
Retinoblastoma 2D02.2 Uvea 2.30E-05 1.12E+00 6.09E+00
Rheumatoid arthritis FA20 Synovial tissue 3.69E-03 1.32E-01 7.13E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.31E-02 3.71E-02 2.41E-01
Schizophrenia 6A20 Prefrontal cortex 3.65E-01 -3.94E-02 -1.16E-01
Schizophrenia 6A20 Superior temporal cortex 9.79E-01 2.47E-02 2.08E-01
Scleroderma 4A42.Z Whole blood 4.25E-02 7.64E-02 6.79E-01
Seizure 8A60-8A6Z Whole blood 3.38E-01 -4.79E-02 -3.17E-01
Sensitive skin EK0Z Skin 7.22E-01 1.53E-01 6.59E-01
Sepsis with septic shock 1G41 Whole blood 1.23E-09 -1.37E-01 -5.86E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.79E-01 -1.33E-02 -6.07E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.57E-01 8.75E-03 6.31E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 1.49E-01 -1.23E-01 -5.52E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.33E-01 -6.47E-02 -6.54E-01
Skin cancer 2C30-2C3Z Skin 1.57E-17 3.26E-01 1.05E+00
Thrombocythemia 3B63 Whole blood 9.32E-07 -1.37E-01 -1.27E+00
Thrombocytopenia 3B64 Whole blood 9.18E-01 5.24E-02 1.42E-01
Thyroid cancer 2D10 Thyroid 4.17E-05 8.58E-02 3.60E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.36E-02 -1.62E-01 -8.51E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.18E-01 2.69E-02 1.60E-01
Type 2 diabetes 5A11 Liver tissue 9.04E-01 -1.58E-01 -9.76E-01
Ureter cancer 2C92 Urothelium 5.64E-01 2.16E-02 1.72E-01
Uterine cancer 2C78 Endometrium tissue 2.02E-06 1.76E-01 5.87E-01
Vitiligo ED63.0 Skin 7.23E-01 -1.72E-02 -6.78E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name S-methyl-5'-thioadenosine phosphorylase (MTAP) DTT Info
DME DTT Type Literature-reported
1 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
METHYLTHIOADENOSINE DMC8J6F Multiple sclerosis 8A40 Terminated [1]
2 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
5'-Deoxy-5'-(Methylthio)-Tubercidin DMR28HG Discovery agent N.A. Investigative [1]
Formycin DMWG0P3 Discovery agent N.A. Investigative [1]

References

1 How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
2 Picomolar transition state analogue inhibitors of human 5'-methylthioadenosine phosphorylase and X-ray structure with MT-immucillin-A. Biochemistry. 2004 Jan 13;43(1):9-18.