Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEZGVDW)

DME Name Steroid 5-alpha-reductase 3 (SRD5A3)
Synonyms Alpha-reductase steroid 3; 3-oxo-5-alpha-steroid 4-dehydrogenase 3; Polyprenol reductase; S5AR 3; SR type 3; SRD5A2L; SRD5A3; Steroid 5-alpha-reductase 2-like
Gene Name SRD5A3
UniProt ID
PORED_HUMAN
INTEDE ID
DME0219
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
79644
EC Number EC: 1.3.1.22
Oxidoreductase
CH-CH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.3.1.22
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEP
SRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQF
QGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQ
VPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNH
RIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYK
SKFVSYPKHRKAFLPFLF
Function
This enzyme plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. It acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism and is also able to convert testosterone (T) into 5- alpha-dihydrotestosterone (DHT).
KEGG Pathway
N-Glycan biosynthesis (hsa00510 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Defective SRD5A3 causes SRD5A3-CDG (CDG-1q) and KHRZ (R-HSA-4755579 )
Synthesis of Dolichyl-phosphate (R-HSA-446199 )
Androgen biosynthesis (R-HSA-193048 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Testosterone cypionate DMC1TEV N. A. N. A. Approved [1]
Testosterone enanthate DMB6871 N. A. N. A. Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.27E-33 4.10E-01 1.60E+00
Alopecia ED70 Skin from scalp 3.82E-01 1.75E-01 2.11E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.74E-02 -2.04E-01 -5.23E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.48E-01 1.87E-01 5.03E-01
Aortic stenosis BB70 Calcified aortic valve 4.53E-01 -2.58E-01 -6.41E-01
Apnea 7A40 Hyperplastic tonsil 2.10E-01 -7.89E-01 -1.70E+00
Arthropathy FA00-FA5Z Peripheral blood 6.82E-02 -1.57E-01 -4.98E-01
Asthma CA23 Nasal and bronchial airway 3.75E-05 2.38E-01 3.41E-01
Atopic dermatitis EA80 Skin 1.41E-01 1.10E-02 2.92E-02
Autism 6A02 Whole blood 6.89E-01 6.88E-04 4.01E-03
Autoimmune uveitis 9A96 Peripheral monocyte 4.62E-01 -8.32E-03 -3.72E-02
Autosomal dominant monocytopenia 4B04 Whole blood 7.22E-01 3.57E-02 2.63E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.45E-09 -4.56E-01 -8.34E-01
Batten disease 5C56.1 Whole blood 9.86E-01 4.30E-02 1.56E-01
Behcet's disease 4A62 Peripheral blood 9.45E-01 1.77E-01 2.54E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.11E-01 1.16E-01 4.87E-01
Bladder cancer 2C94 Bladder tissue 9.60E-01 1.80E-01 2.61E-01
Breast cancer 2C60-2C6Z Breast tissue 9.21E-63 7.17E-01 1.32E+00
Cardioembolic stroke 8B11.20 Whole blood 8.20E-01 1.59E-01 2.37E-01
Cervical cancer 2C77 Cervical tissue 2.62E-01 6.01E-02 5.02E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.79E-01 -7.92E-02 -1.65E-01
Chronic hepatitis C 1E51.1 Whole blood 6.15E-01 -2.51E-02 -1.33E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.20E-01 -3.99E-02 -1.11E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.71E-01 9.62E-02 1.95E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.52E-02 1.78E+00 2.56E+00
Colon cancer 2B90 Colon tissue 1.15E-17 3.92E-01 7.37E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.24E-02 2.51E-01 1.01E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.47E-01 -3.22E-02 -1.79E-01
Endometriosis GA10 Endometrium tissue 6.20E-02 3.80E-01 6.30E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.15E-01 -1.59E-01 -4.06E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.10E-03 6.99E-01 1.14E+00
Gastric cancer 2B72 Gastric tissue 6.27E-02 8.70E-01 1.59E+00
Glioblastopma 2A00.00 Nervous tissue 4.59E-01 -8.66E-02 -1.88E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.54E-01 1.08E-03 2.87E-03
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.41E-01 -1.30E-01 -1.59E-01
Head and neck cancer 2D42 Head and neck tissue 1.35E-10 -6.80E-01 -8.52E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.02E-01 1.36E-01 3.69E-01
Huntington's disease 8A01.10 Whole blood 7.01E-01 8.29E-03 7.43E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.52E-01 5.99E-02 1.06E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.18E-01 -5.28E-02 -1.47E-01
Influenza 1E30 Whole blood 1.16E-01 -1.16E+00 -1.58E+00
Interstitial cystitis GC00.3 Bladder tissue 1.69E-01 -3.64E-01 -6.98E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.67E-01 1.09E-02 4.46E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.45E-01 -3.65E-02 -3.51E-02
Ischemic stroke 8B11 Peripheral blood 1.30E-01 -1.12E-01 -2.80E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.31E-01 5.85E-02 9.93E-02
Lateral sclerosis 8B60.4 Skin 8.31E-01 3.92E-02 6.69E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 8.44E-01 2.57E-01 5.88E-01
Liver cancer 2C12.0 Liver tissue 1.84E-09 3.27E-01 8.90E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.90E-01 2.25E-01 6.53E-01
Lung cancer 2C25 Lung tissue 1.00E-51 6.60E-01 1.41E+00
Lupus erythematosus 4A40 Whole blood 2.05E-01 1.47E-01 1.62E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.03E-01 1.26E-01 4.91E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.73E-01 3.52E-01 3.40E-01
Melanoma 2C30 Skin 2.19E-02 -1.03E+00 -6.99E-01
Multiple myeloma 2A83.1 Peripheral blood 1.73E-01 -3.12E-01 -4.61E-01
Multiple myeloma 2A83.1 Bone marrow 1.89E-04 4.31E-01 1.93E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.69E-01 -1.60E-01 -4.11E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.02E-01 -2.93E-02 -8.90E-02
Myelofibrosis 2A20.2 Whole blood 2.61E-01 6.55E-02 2.76E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.45E-02 -4.55E-01 -4.94E-01
Myopathy 8C70.6 Muscle tissue 4.95E-03 3.98E-01 1.66E+00
Neonatal sepsis KA60 Whole blood 1.82E-04 1.05E-01 4.51E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.91E-04 1.03E+00 1.98E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.82E-01 -1.42E-01 -1.69E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.60E-01 1.85E-01 5.12E-01
Olive pollen allergy CA08.00 Peripheral blood 1.01E-01 1.23E-01 2.84E-01
Oral cancer 2B6E Oral tissue 6.37E-01 1.44E-01 1.87E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.43E-02 4.12E-01 1.16E+00
Osteoporosis FB83.1 Bone marrow 4.07E-01 -1.57E-01 -2.75E-01
Ovarian cancer 2C73 Ovarian tissue 5.31E-08 1.57E+00 4.94E+00
Pancreatic cancer 2C10 Pancreas 6.47E-05 7.93E-01 1.36E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.81E-01 -4.59E-02 -9.60E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.99E-02 -1.24E-01 -4.68E-01
Pituitary cancer 2D12 Pituitary tissue 2.87E-01 1.35E-01 3.17E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.53E-01 5.07E-01 1.05E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.52E-01 -3.00E-02 -2.42E-01
Polycythemia vera 2A20.4 Whole blood 1.00E+00 -1.24E-03 -5.11E-03
Pompe disease 5C51.3 Biceps muscle 7.16E-01 6.16E-02 1.90E-01
Preterm birth KA21.4Z Myometrium 7.78E-01 -2.11E-01 -5.12E-01
Prostate cancer 2C82 Prostate 1.06E-04 1.86E+00 1.63E+00
Psoriasis EA90 Skin 5.68E-19 8.91E-01 1.49E+00
Rectal cancer 2B92 Rectal colon tissue 2.22E-01 -2.77E-01 -4.25E-01
Renal cancer 2C90-2C91 Kidney 4.25E-07 1.41E+00 3.54E+00
Retinoblastoma 2D02.2 Uvea 1.28E-11 2.27E+00 6.80E+00
Rheumatoid arthritis FA20 Synovial tissue 4.08E-02 2.53E-01 7.32E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.94E-01 -1.54E-01 -3.72E-01
Schizophrenia 6A20 Prefrontal cortex 6.89E-02 -7.63E-02 -1.65E-01
Schizophrenia 6A20 Superior temporal cortex 7.35E-01 -7.43E-03 -5.45E-02
Scleroderma 4A42.Z Whole blood 7.00E-01 5.55E-02 1.62E-01
Seizure 8A60-8A6Z Whole blood 2.39E-01 -2.24E-01 -1.12E+00
Sensitive skin EK0Z Skin 6.56E-01 2.77E-02 9.33E-02
Sepsis with septic shock 1G41 Whole blood 8.71E-08 4.72E-02 1.84E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.32E-01 -2.36E-01 -6.19E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.66E-01 3.65E-02 2.47E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.04E-01 1.24E-01 8.13E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.29E-01 1.67E-01 5.61E-01
Skin cancer 2C30-2C3Z Skin 1.33E-01 1.58E-01 1.64E-01
Thrombocythemia 3B63 Whole blood 7.33E-01 -1.20E-01 -4.58E-01
Thrombocytopenia 3B64 Whole blood 7.93E-01 3.67E-02 3.63E-02
Thyroid cancer 2D10 Thyroid 6.60E-02 -1.00E-01 -1.94E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.97E-04 4.18E-01 2.17E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.04E-02 -3.01E-01 -3.49E+00
Type 2 diabetes 5A11 Liver tissue 9.47E-01 -1.27E-01 -5.47E-01
Ureter cancer 2C92 Urothelium 3.24E-01 3.65E-03 2.61E-02
Uterine cancer 2C78 Endometrium tissue 2.25E-03 -4.80E-01 -3.99E-01
Vitiligo ED63.0 Skin 3.46E-04 7.04E-01 2.22E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Molecular analysis of the SRD5A1 and SRD5A2 genes in patients with benign prostatic hyperplasia with regard to metabolic parameters and selected hormone levels. Int J Environ Res Public Health. 2017 Oct 30;14(11).