General Information of Drug-Metabolizing Enzyme (DME) (ID: DEZSNJD)

DME Name Glutathione S-transferase omega-1 (GSTO1)
Synonyms
Glutathione S-transferase omega 1-1; Glutathione-dependent dehydroascorbate reductase; MMA(V) reductase; Monomethylarsonic acid reductase; S-(Phenacyl)glutathione reductase; SPG-R; GSTO 1-1; GSTO-1; GSTO1; GSTTLP28
Gene Name GSTO1
UniProt ID
GSTO1_HUMAN
INTEDE ID
DME0313
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
9446
EC Number EC: 2.5.1.18
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.18
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
L
Function
This enzyme exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. It has both S-(phenacyl)glutathione reductase and glutathione S-transferase activity. It participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Fluid shear stress and atherosclerosis (hsa05418 )
Glutathione metabolism (hsa00480 )
Hepatocellular carcinoma (hsa05225 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pathways in cancer (hsa05200 )
Platinum drug resistance (hsa01524 )
Reactome Pathway
Glutathione conjugation (R-HSA-156590 )
Methylation (R-HSA-156581 )
Vitamin C (ascorbate) metabolism (R-HSA-196836 )
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glutathione DMAHMT9 Human immunodeficiency virus infection 1C62 Approved [2]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
dehydroascorbic acid DMKYQO4 Discovery agent N.A. Investigative [2]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
dehydroascorbic acid Discovery agent [N.A.] Investigative Km = 0.43 microM [2]
Glutathione Human immunodeficiency virus infection [1C62] Approved Km = 4.18 microM [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.72E-11 -1.79E-01 -5.28E-01
Alopecia ED70 Skin from scalp 6.23E-01 3.52E-02 8.42E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.26E-04 -1.93E-01 -5.30E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.69E-01 7.23E-02 3.61E-01
Aortic stenosis BB70 Calcified aortic valve 6.92E-01 1.24E-01 1.21E-01
Apnea 7A40 Hyperplastic tonsil 1.55E-01 -5.93E-01 -1.21E+00
Arthropathy FA00-FA5Z Peripheral blood 4.61E-01 -3.31E-02 -1.68E-01
Asthma CA23 Nasal and bronchial airway 6.50E-03 1.49E-01 2.77E-01
Atopic dermatitis EA80 Skin 6.66E-01 4.17E-02 1.94E-01
Autism 6A02 Whole blood 6.10E-01 1.15E-01 1.91E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.27E-01 -1.57E-01 -5.29E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.82E-03 1.31E+00 2.05E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.47E-02 1.44E-01 4.03E-01
Batten disease 5C56.1 Whole blood 8.68E-01 1.59E-01 3.00E-01
Behcet's disease 4A62 Peripheral blood 1.78E-01 9.55E-02 4.05E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.48E-01 -1.32E-01 -3.59E-01
Bladder cancer 2C94 Bladder tissue 2.10E-04 -3.63E-01 -2.45E+00
Breast cancer 2C60-2C6Z Breast tissue 6.76E-21 4.60E-01 1.15E+00
Cardioembolic stroke 8B11.20 Whole blood 3.84E-02 -8.18E-02 -3.65E-01
Cervical cancer 2C77 Cervical tissue 5.37E-01 -9.67E-02 -2.67E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.92E-01 1.57E-01 2.47E-01
Chronic hepatitis C 1E51.1 Whole blood 6.52E-01 3.59E-01 6.21E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.38E-01 -5.25E-02 -1.38E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.12E-02 2.70E-01 7.45E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.68E-01 3.54E-01 7.73E-01
Colon cancer 2B90 Colon tissue 1.68E-27 3.81E-01 9.93E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.90E-02 3.92E-01 1.05E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.15E-01 -6.33E-02 -1.18E-01
Endometriosis GA10 Endometrium tissue 9.59E-01 -1.27E-01 -1.37E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.27E-01 1.48E-02 7.02E-02
Familial hypercholesterolemia 5C80.00 Whole blood 6.79E-15 1.77E+00 2.12E+00
Gastric cancer 2B72 Gastric tissue 1.55E-01 9.02E-01 1.35E+00
Glioblastopma 2A00.00 Nervous tissue 1.15E-41 -4.47E-01 -9.30E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.34E-01 -4.11E-01 -1.48E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.73E-03 7.99E-01 1.41E+00
Head and neck cancer 2D42 Head and neck tissue 7.16E-45 9.21E-01 2.56E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.96E-01 1.16E-01 2.34E-01
Huntington's disease 8A01.10 Whole blood 5.57E-01 -3.05E-03 -1.00E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.56E-01 1.94E-01 4.44E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.02E-03 2.46E-01 2.38E+00
Influenza 1E30 Whole blood 6.18E-02 -9.30E-01 -2.32E+00
Interstitial cystitis GC00.3 Bladder tissue 9.72E-01 -7.64E-02 -6.24E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.65E-04 6.00E-01 2.01E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.28E-03 -1.94E-01 -5.31E-01
Ischemic stroke 8B11 Peripheral blood 6.96E-01 2.48E-02 1.14E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.38E-04 -1.64E-01 -4.27E-01
Lateral sclerosis 8B60.4 Skin 1.13E-01 1.91E-01 1.16E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 5.09E-01 -7.31E-02 -7.57E-02
Liver cancer 2C12.0 Liver tissue 2.30E-10 -3.81E-01 -1.16E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.79E-01 -1.31E-01 -4.14E-01
Lung cancer 2C25 Lung tissue 5.05E-28 -3.87E-01 -9.62E-01
Lupus erythematosus 4A40 Whole blood 4.70E-06 3.85E-01 6.74E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.13E-01 4.27E-02 1.37E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.70E-01 -4.00E-02 -1.18E-01
Melanoma 2C30 Skin 4.15E-04 1.12E+00 1.21E+00
Multiple myeloma 2A83.1 Peripheral blood 5.05E-01 2.89E-03 3.76E-03
Multiple myeloma 2A83.1 Bone marrow 4.93E-05 1.38E+00 3.01E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.77E-01 3.19E-01 1.74E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.82E-01 -3.82E-02 -1.04E-01
Myelofibrosis 2A20.2 Whole blood 1.35E-02 4.54E-01 1.56E+00
Myocardial infarction BA41-BA50 Peripheral blood 9.30E-02 -4.25E-02 -6.50E-02
Myopathy 8C70.6 Muscle tissue 1.30E-03 4.96E-01 1.48E+00
Neonatal sepsis KA60 Whole blood 1.77E-24 7.77E-01 1.60E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.97E-02 4.73E-01 9.95E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.67E-01 -1.79E-01 -5.83E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.23E-02 -4.07E-01 -1.01E+00
Olive pollen allergy CA08.00 Peripheral blood 6.58E-01 3.70E-01 1.04E+00
Oral cancer 2B6E Oral tissue 1.84E-04 7.25E-01 1.29E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.38E-02 8.71E-01 1.12E+00
Osteoporosis FB83.1 Bone marrow 2.57E-01 -3.19E-01 -9.47E-01
Ovarian cancer 2C73 Ovarian tissue 5.56E-01 -1.10E-01 -2.83E-01
Pancreatic cancer 2C10 Pancreas 4.04E-08 6.79E-01 2.36E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.44E-01 -2.61E-01 -6.33E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.58E-07 5.06E-01 1.88E+00
Pituitary cancer 2D12 Pituitary tissue 2.40E-01 -3.20E-01 -6.15E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.56E-03 -5.13E-01 -1.57E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.20E-05 -2.06E-01 -1.12E+00
Polycythemia vera 2A20.4 Whole blood 9.69E-05 2.27E-01 7.47E-01
Pompe disease 5C51.3 Biceps muscle 3.06E-04 7.86E-01 2.50E+00
Preterm birth KA21.4Z Myometrium 1.31E-02 -9.00E-01 -1.74E+00
Prostate cancer 2C82 Prostate 6.36E-05 -3.21E-01 -6.55E-01
Psoriasis EA90 Skin 1.42E-01 3.60E-02 1.29E-01
Rectal cancer 2B92 Rectal colon tissue 2.47E-01 -3.42E-01 -9.20E-01
Renal cancer 2C90-2C91 Kidney 2.43E-02 6.77E-01 1.21E+00
Retinoblastoma 2D02.2 Uvea 1.14E-13 2.00E+00 6.45E+00
Rheumatoid arthritis FA20 Synovial tissue 1.20E-09 1.32E+00 5.52E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.00E-01 -6.59E-03 -3.67E-02
Schizophrenia 6A20 Prefrontal cortex 7.07E-01 3.39E-02 6.16E-02
Schizophrenia 6A20 Superior temporal cortex 8.95E-01 -8.90E-02 -2.61E-01
Scleroderma 4A42.Z Whole blood 1.32E-03 2.66E-01 1.71E+00
Seizure 8A60-8A6Z Whole blood 7.37E-03 3.98E-01 1.20E+00
Sensitive skin EK0Z Skin 8.01E-02 1.23E-01 1.99E+00
Sepsis with septic shock 1G41 Whole blood 1.34E-58 8.96E-01 1.77E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.58E-01 -1.76E-01 -9.14E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.25E-02 6.07E-01 1.60E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 7.50E-01 6.90E-02 1.49E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.03E-01 -1.95E-01 -1.32E+00
Skin cancer 2C30-2C3Z Skin 5.78E-55 8.27E-01 2.31E+00
Thrombocythemia 3B63 Whole blood 5.72E-03 1.81E-01 6.24E-01
Thrombocytopenia 3B64 Whole blood 6.20E-01 3.55E-01 3.86E-01
Thyroid cancer 2D10 Thyroid 6.25E-07 2.30E-01 6.24E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.85E-03 -4.58E-01 -9.72E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.39E-03 -3.74E-01 -2.46E+00
Type 2 diabetes 5A11 Liver tissue 2.55E-01 -6.60E-02 -4.83E-01
Ureter cancer 2C92 Urothelium 7.49E-01 -4.92E-02 -1.04E-01
Uterine cancer 2C78 Endometrium tissue 5.26E-03 -1.33E-01 -2.90E-01
Vitiligo ED63.0 Skin 5.91E-01 9.24E-02 4.88E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Glutathione S-transferase omega-1 (GSTO-1) DTT Info
DME DTT Type Preclinical
1 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Piperlongumine DMIZCOE Solid tumour/cancer 2A00-2F9Z Preclinical [1]

References

1 Activity-based protein profiling reveals GSTO1 as the covalent target of piperlongumine and a promising target for combination therapy for cancer. Chem Commun (Camb). 2019 Apr 9;55(30):4407-4410.
2 Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases. J Mol Biol. 2012 Jul 13;420(3):190-203.
3 Characterization of the monomethylarsonate reductase and dehydroascorbate reductase activities of Omega class glutathione transferase variants: implications for arsenic metabolism and the age-at-onset of Alzheimer's and Parkinson's diseases. Pharmacogenet Genomics. 2005 Jul;15(7):493-501.