Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWO3SH)

DTT Name	Glutathione S-transferase omega-1 (GSTO-1)
Synonyms	SPG-R; S-(Phenacyl)glutathione reductase; Monomethylarsonic acid reductase; MMA(V) reductase; Glutathione-dependent dehydroascorbate reductase; Glutathione S-transferase omega 1-1; GSTTLP28; GSTO-1; GSTO 1-1
Gene Name	GSTO1
DTT Type	Preclinical target	[1]
UniProt ID	GSTO1_HUMAN
TTD ID	T01521
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 2.5.1.18
Sequence	MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG L
Function	Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.
KEGG Pathway	Glutathione metabolism (hsa00480 ) Metabolism of xenobiotics by cytochrome P450 (hsa00980 ) Drug metabolism - cytochrome P450 (hsa00982 ) Drug metabolism - other enzymes (hsa00983 ) Metabolic pathways (hsa01100 ) Platinum drug resistance (hsa01524 ) Pathways in cancer (hsa05200 ) Chemical carcinogenesis - DNA adducts (hsa05204 ) Chemical carcinogenesis - receptor activation (hsa05207 ) Chemical carcinogenesis - reactive oxygen species (hsa05208 ) Hepatocellular carcinoma (hsa05225 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	Glutathione conjugation (R-HSA-156590 ) Vitamin C (ascorbate) metabolism (R-HSA-196836 ) Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505 ) Methylation (R-HSA-156581 )
BioCyc Pathway	MetaCyc:HS07564-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Piperlongumine	DMIZCOE	Solid tumour/cancer	2A00-2F9Z	Preclinical	[2]
------------------------------------------------------------------------------------

The Drug-Metabolizing Enzyme (DME) Role of This DTT

DTT DME Name

Glutathione S-transferase omega-1 (GSTO1) DME Info

Gene Name

GSTO1

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Glutathione	DMAHMT9	Human immunodeficiency virus infection	1C62	Approved	[3]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
dehydroascorbic acid	DMKYQO4	Discovery agent	N.A.	Investigative	[3]
------------------------------------------------------------------------------------

References

1	Mechanistic evaluation and transcriptional signature of a glutathione S-transferase omega 1 inhibitor. Nat Commun. 2016 Oct 5;7:13084.
2	Activity-based protein profiling reveals GSTO1 as the covalent target of piperlongumine and a promising target for combination therapy for cancer. Chem Commun (Camb). 2019 Apr 9;55(30):4407-4410.
3	Structural insights into the dehydroascorbate reductase activity of human omega-class glutathione transferases. J Mol Biol. 2012 Jul 13;420(3):190-203.