Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0GVQPP)

DOT Name	Uncharacterized protein C20orf204 (C20ORF204)
Gene Name	C20ORF204
Related Disease	Epithelial ovarian cancer ( ) Ovarian cancer ( ) Ovarian neoplasm ( ) Hepatocellular carcinoma ( ) Neoplasm ( )
UniProt ID	CT204_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MVPPKPALWALLLALLGTAPSRAYSPACSVPDVLRHYRAIIFEDLQAAVKWGGAGAEKTR PGSRHFHFIQKNLTRPGSSGRRGRPRASCGAQKEHSILLSISSLGRTLRGAVAGGRRGAL ERAAWTVAVRTEAVMRRHCRTLRQRSRRPKMRPARRRGGRRQLLLRALDAVATCWEKLFA LRAPASRDS

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[1]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[1]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[1]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[2]
Neoplasm	DISZKGEW	Limited	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Uncharacterized protein C20orf204 (C20ORF204).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Uncharacterized protein C20orf204 (C20ORF204).	[4]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Uncharacterized protein C20orf204 (C20ORF204).	[5]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Uncharacterized protein C20orf204 (C20ORF204).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Uncharacterized protein C20orf204 (C20ORF204).	[4]
------------------------------------------------------------------------------------

References

1	Knockdown of long non-coding RNA LINC00176 suppresses ovarian cancer progression by BCL3-mediated down-regulation of ceruloplasmin.J Cell Mol Med. 2020 Jan;24(1):202-213. doi: 10.1111/jcmm.14701. Epub 2019 Oct 30.
2	Myc target gene, long intergenic noncoding RNA, Linc00176 in hepatocellular carcinoma regulates cell cycle and cell survival by titrating tumor suppressor microRNAs.Oncogene. 2018 Jan 4;37(1):75-85. doi: 10.1038/onc.2017.312. Epub 2017 Sep 4.
3	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
4	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
6	Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.