Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT11OABF)

DOT Name TBC1 domain family member 25 (TBC1D25)
Gene Name TBC1D25
Related Disease
Papillary renal cell carcinoma ( )
Alveolar soft part sarcoma ( )
Intellectual disability, X-linked 9 ( )
Mood disorder ( )
Synovial sarcoma ( )
Wiskott-Aldrich syndrome ( )
Neoplasm ( )
UniProt ID
TBC25_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00566
Sequence
MATASGASDLSGSGAPPPGVGAQAAAAAEEEEREVVRVRVKKCESFLPPEFRSFAVDPQI
TSLDVLQHILIRAFDLSGKKNFGISYLGRDRLGQEVYLSLLSDWDLSTAFATASKPYLQL
RVDIRPSEDSPLLEDWDIISPKDVIGSDVLLAEKRSSLTTAALPFTQSILTQVGRTLSKV
QQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRY
LLNVYPDGLTGRERMDYMKRKSREYEQLKSEWAQRANPEDLEFIRSTVLKDVLRTDRAHP
YYAGPEDGPHLRALHDLLTTYAVTHPQVSYCQGMSDLASPILAVMDHEGHAFVCFCGIMK
RLAANFHPDGRAMATKFAHLKLLLRHADPDFYQYLQEAGADDLFFCYRWLLLELKREFAF
DDALRMLEVTWSSLPPDPPEHEVELVGPPSQVADAGFGGHRGWPVRQRHMLRPAGGGGST
FEDAVDHLATASQGPGGGGRLLRQASLDGLQQLRDNMGSRRDPLVQLPHPAALISSKSLS
EPLLNSPDPLLSSFSHPDSPSSSSPPSTQEASPTGDMAVGSPLMQEVGSPKDPGKSLPPV
PPMGLPPPQEFGRGNPFMLFLCLAILLEHRDHIMRNGLDYNELAMHFDRLVRKHHLGRVL
RRARALFADYLQSEVWDSEEGAEATAAS
Function Acts as a GTPase-activating protein specific for RAB33B. Involved in the regulation of autophagosome maturation, the process in which autophagosomes fuse with endosomes and lysosomes.
Reactome Pathway
TBC/RABGAPs (R-HSA-8854214 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Papillary renal cell carcinoma DIS25HBV Definitive Genetic Variation [1]
Alveolar soft part sarcoma DISLKJKZ Strong Genetic Variation [2]
Intellectual disability, X-linked 9 DISWT4BP Strong Genetic Variation [3]
Mood disorder DISLVMWO Strong Biomarker [4]
Synovial sarcoma DISEZJS7 Strong Biomarker [5]
Wiskott-Aldrich syndrome DISATMDB Strong Genetic Variation [6]
Neoplasm DISZKGEW Limited Genetic Variation [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of TBC1 domain family member 25 (TBC1D25). [8]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of TBC1 domain family member 25 (TBC1D25). [9]
Progesterone DMUY35B Approved Progesterone increases the expression of TBC1 domain family member 25 (TBC1D25). [10]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of TBC1 domain family member 25 (TBC1D25). [11]
ACYLINE DM9GRTK Phase 2 ACYLINE decreases the expression of TBC1 domain family member 25 (TBC1D25). [12]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of TBC1 domain family member 25 (TBC1D25). [13]
------------------------------------------------------------------------------------

References

1 Localization of X chromosome short arm markers relative to synovial sarcoma- and renal adenocarcinoma-associated translocation breakpoints.Hum Genet. 1993 Oct 1;92(3):305-8. doi: 10.1007/BF00244478.
2 The der(17)t(X;17)(p11;q25) of human alveolar soft part sarcoma fuses the TFE3 transcription factor gene to ASPL, a novel gene at 17q25.Oncogene. 2001 Jan 4;20(1):48-57. doi: 10.1038/sj.onc.1204074.
3 Localization of a gene responsible for nonspecific mental retardation (MRX9) to the pericentromeric region of the X chromosome.Genomics. 1993 Nov;18(2):290-4. doi: 10.1006/geno.1993.1468.
4 Association of polyaminergic loci with anxiety, mood disorders, and attempted suicide.PLoS One. 2010 Nov 30;5(11):e15146. doi: 10.1371/journal.pone.0015146.
5 Identification of a yeast artificial chromosome (YAC) spanning the synovial sarcoma-specific t(X;18)(p11.2;q11.2) breakpoint.Genes Chromosomes Cancer. 1993 Mar;6(3):182-9. doi: 10.1002/gcc.2870060309.
6 A high-resolution map of genes, microsatellite markers, and new dinucleotide repeats from UBE1 to the GATA locus in the region Xp11.23.Genomics. 1995 Sep 1;29(1):247-52. doi: 10.1006/geno.1995.1238.
7 Interphase cytogenetic analysis of distinct X-chromosomal translocation breakpoints in synovial sarcoma.J Pathol. 1995 Apr;175(4):391-6. doi: 10.1002/path.1711750405.
8 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
9 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
10 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
11 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
12 Intraprostatic androgens and androgen-regulated gene expression persist after testosterone suppression: therapeutic implications for castration-resistant prostate cancer. Cancer Res. 2007 May 15;67(10):5033-41.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.