Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1AI7NF)

• DOT Name: MORF4 family-associated protein 1 (MRFAP1)
• Synonyms: Protein PGR1; Protein associated with MRG of 14 kDa
• Gene Name: MRFAP1
• Related Disease:
  Hyper-IgM syndrome type 1
  Gastric cancer
  Malignant mesothelioma
  Stomach cancer
• UniProt ID: MOFA1_HUMAN
• Pfam ID: PF15155
• Sequence:
  MRPLDIVELAEPEEVEVLEPEEDFEQFLLPVINEMREDIASLTREHGRAYLRNRSKLWEM
  DNMLIQIKTQVEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVELVRR
  IEKSESS

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hyper-IgM syndrome type 1	DISC91LV	moderate	Genetic Variation	[1]
Gastric cancer	DISXGOUK	Limited	Biomarker	[2]
Malignant mesothelioma	DISTHJGH	Limited	Biomarker	[3]
Stomach cancer	DISKIJSX	Limited	Biomarker	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of MORF4 family-associated protein 1 (MRFAP1).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of MORF4 family-associated protein 1 (MRFAP1).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of MORF4 family-associated protein 1 (MRFAP1).	[6]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of MORF4 family-associated protein 1 (MRFAP1).	[7]

References

• [1] The molecular basis of X-linked agammaglobulinemia, hyper-IgM syndrome, and severe combined immunodeficiency in humans.Curr Opin Hematol. 1994 Jan;1(1):12-8.
• [2] MRFAP1 plays a protective role in neddylation inhibitor MLN4924-mediated gastric cancer cell death.Eur Rev Med Pharmacol Sci. 2018 Dec;22(23):8273-8280. doi: 10.26355/eurrev_201812_16524.
• [3] Distinct DNA methylation profiles in malignant mesothelioma, lung adenocarcinoma, and non-tumor lung.Lung Cancer. 2005 Feb;47(2):193-204. doi: 10.1016/j.lungcan.2004.08.003.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [7] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.