Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1BMJ6B)

DOT Name	Thymosin beta-4, Y-chromosomal (TMSB4Y)
Gene Name	TMSB4Y
Related Disease	Male breast carcinoma ( ) Neoplasm ( )
UniProt ID	TYB4Y_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF01290
Sequence	MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Tissue Specificity	Ubiquitous.
KEGG Pathway	Regulation of actin cytoskeleton (hsa04810 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Male breast carcinoma	DISUNQ2Q	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Thymosin beta-4, Y-chromosomal (TMSB4Y).	[2]
------------------------------------------------------------------------------------

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Thymosin beta-4, Y-chromosomal (TMSB4Y).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Thymosin beta-4, Y-chromosomal (TMSB4Y).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Thymosin beta-4, Y-chromosomal (TMSB4Y).	[5]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Thymosin beta-4, Y-chromosomal (TMSB4Y).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Thymosin beta-4, Y-chromosomal (TMSB4Y).	[7]
------------------------------------------------------------------------------------

References

1	TMSB4Y is a candidate tumor suppressor on the Y chromosome and is deleted in male breast cancer.Oncotarget. 2015 Dec 29;6(42):44927-40. doi: 10.18632/oncotarget.6743.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6	Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
7	Gene expression changes associated with altered growth and differentiation in benzo[a]pyrene or arsenic exposed normal human epidermal keratinocytes. J Appl Toxicol. 2008 May;28(4):491-508.