Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1CO9ED)

DOT Name Homeobox protein goosecoid-2 (GSC2)
Synonyms GSC-2; Homeobox protein goosecoid-like; GSC-L
Gene Name GSC2
Related Disease
DiGeorge syndrome ( )
Mental disorder ( )
Velocardiofacial syndrome ( )
Meningioma ( )
UniProt ID
GSC2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MAAAAGGAASRRGAGRPCPFSIEHILSSLPERSLPARAACPPQPAGRQSPAKPEEPGAPE
AAPCACCCCCGPRAAPCGPPEAAAGLGARLAWPLRLGPAVPLSLGAPAGGSGALPGAVGP
GSQRRTRRHRTIFSEEQLQALEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAK
WRHQKRASASARLLPGVKKSPKGSC
Function May have a role in development. May regulate its own transcription. May bind the bicoid consensus sequence TAATCC.
Tissue Specificity Detected in adult testis and pituitary, and in 9-10 week fetal tissue (thorax). Probably expressed in other tissues at low levels.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
DiGeorge syndrome DIST1RKO Strong Genetic Variation [1]
Mental disorder DIS3J5R8 Strong Biomarker [1]
Velocardiofacial syndrome DISOSBTY Strong Genetic Variation [1]
Meningioma DISPT4TG moderate Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Homeobox protein goosecoid-2 (GSC2). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Homeobox protein goosecoid-2 (GSC2). [4]
------------------------------------------------------------------------------------

References

1 Goosecoid-like, a gene deleted in DiGeorge and velocardiofacial syndromes, recognizes DNA with a bicoid-like specificity and is expressed in the developing mouse brain.Hum Mol Genet. 1998 Sep;7(9):1497-505. doi: 10.1093/hmg/7.9.1497.
2 Chromosomal and genetic abnormalities in benign and malignant meningiomas using DNA microarray.Neurol Res. 2005 Oct;27(7):747-54. doi: 10.1179/016164105X35648.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.