Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1SCOTY)

• DOT Name: Membrane protein FAM174B (FAM174B)
• Gene Name: FAM174B
• UniProt ID: F174B_HUMAN
• Pfam ID: PF06679
• Sequence:
  MRAVPLPAPLLPLLLLALLAAPAARASRAESVSAPWPEPERESRPPPGPGPGNTTRFGSG
  AAGGSGSSSSNSSGDALVTRISILLRDLPTLKAAVIVAFAFTTLLIACLLLRVFRSGKRL
  KKTRKYDIITTPAERVEMAPLNEEDDEDEDSTVFDIKYR
• Function: Essential for Golgi structural integrity.

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Membrane protein FAM174B (FAM174B).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Membrane protein FAM174B (FAM174B).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Membrane protein FAM174B (FAM174B).	[3]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Membrane protein FAM174B (FAM174B).	[4]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Membrane protein FAM174B (FAM174B).	[5]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Membrane protein FAM174B (FAM174B).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Membrane protein FAM174B (FAM174B).	[8]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Membrane protein FAM174B (FAM174B).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Membrane protein FAM174B (FAM174B).	[10]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Membrane protein FAM174B (FAM174B).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Membrane protein FAM174B (FAM174B).	[7]

References

• [1] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [5] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [9] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [10] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [11] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.