Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT23700G)

DOT Name Nascent polypeptide-associated complex subunit alpha-2 (NACA2)
Synonyms Alpha-NAC-like; Hom s 2.01; Nascent polypeptide-associated complex subunit alpha-like; NAC-alpha-like
Gene Name NACA2
Related Disease
Clubfoot ( )
Nervous system disease ( )
UniProt ID
NACA2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF19026 ; PF01849
Sequence
MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEID
EEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAY
IVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKD
VKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Function
Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites).
Tissue Specificity Expressed specifically in testis and skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Clubfoot DISLXT4S Strong Biomarker [1]
Nervous system disease DISJ7GGT Disputed Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Marinol DM70IK5 Approved Marinol decreases the expression of Nascent polypeptide-associated complex subunit alpha-2 (NACA2). [3]
------------------------------------------------------------------------------------

References

1 Studies of TBX4 and chromosome 17q23.1q23.2: an uncommon cause of nonsyndromic clubfoot.Am J Med Genet A. 2012 Jul;158A(7):1620-7. doi: 10.1002/ajmg.a.35418. Epub 2012 Jun 7.
2 Atlas of human diseases influenced by genetic variants with extreme allele frequency differences.Hum Genet. 2017 Jan;136(1):39-54. doi: 10.1007/s00439-016-1734-y. Epub 2016 Oct 3.
3 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.