Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2DAIWW)

DOT Name	GTP-binding protein Di-Ras2 (DIRAS2)
Synonyms	Distinct subgroup of the Ras family member 2
Gene Name	DIRAS2
Related Disease	Attention deficit hyperactivity disorder ( )
UniProt ID	DIRA2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2ERX; 6NAZ
Pfam ID	PF00071
Sequence	MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQIT DTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVG NKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG KKSKQQKRKEKLKGKCVIM
Function	Displays low GTPase activity and exists predominantly in the GTP-bound form.
Tissue Specificity	Highly expressed in brain.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of GTP-binding protein Di-Ras2 (DIRAS2).	[2]
------------------------------------------------------------------------------------

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of GTP-binding protein Di-Ras2 (DIRAS2).	[3]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of GTP-binding protein Di-Ras2 (DIRAS2).	[4]
Marinol	DM70IK5	Approved	Marinol decreases the expression of GTP-binding protein Di-Ras2 (DIRAS2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of GTP-binding protein Di-Ras2 (DIRAS2).	[6]
------------------------------------------------------------------------------------

References

1	Expression of the ADHD candidate gene Diras2 in the brain.J Neural Transm (Vienna). 2018 Jun;125(6):913-923. doi: 10.1007/s00702-018-1867-3. Epub 2018 Feb 27.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4	Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
5	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
6	Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.