Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2LPTMI)

DOT Name	B melanoma antigen 4 (BAGE4)
Synonyms	Cancer/testis antigen 2.4; CT2.4
Gene Name	BAGE4
Related Disease	Adenocarcinoma ( ) Advanced cancer ( ) Carcinoma of esophagus ( ) Esophageal cancer ( ) Neoplasm ( ) Neoplasm of esophagus ( ) Rectal carcinoma ( )
UniProt ID	BAGE4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF08180
Sequence	MAAGAVFLALSAQLLQARLMKEESPVVSWWLEPEDGTAL
Function	Unknown. Candidate gene encoding tumor antigens.
Tissue Specificity	Not expressed in normal tissues except in testis. Expressed in melanoma, bladder and lung carcinomas.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Adenocarcinoma	DIS3IHTY	Strong	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[2]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[2]
Rectal carcinoma	DIS8FRR7	Limited	Biomarker	[3]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of B melanoma antigen 4 (BAGE4).	[4]
------------------------------------------------------------------------------------

References

1	Prospective randomized controlled trial to compare laparoscopic distal gastrectomy (D2 lymphadenectomy plus complete mesogastrium excision, D2?CME) with conventional D2 lymphadenectomy for locally advanced gastric adenocarcinoma: study protocol for a randomized controlled trial.Trials. 2018 Aug 9;19(1):432. doi: 10.1186/s13063-018-2790-5.
2	GNAS1 T393C polymorphism is associated with histopathological response to neoadjuvant radiochemotherapy in esophageal cancer.Pharmacogenomics J. 2009 Jun;9(3):202-7. doi: 10.1038/tpj.2009.5. Epub 2009 Mar 10.
3	Effect of Akt activation and experimental pharmacological inhibition on responses to neoadjuvant chemoradiotherapy in rectal cancer.Br J Surg. 2018 Jan;105(2):e192-e203. doi: 10.1002/bjs.10695.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.