Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2ODDUR)

DOT Name	Keratin, type I cytoskeletal 40 (KRT40)
Synonyms	Cytokeratin-40; CK-40; Keratin-40; K40; Type I hair keratin Ka36
Gene Name	KRT40
Related Disease	Gastric cancer ( ) Stomach cancer ( ) Squamous cell carcinoma ( )
UniProt ID	K1C40_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00038
Sequence	MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLL PCYFTGSCNSPCLVGNCAWCEDGVFTSNEKETMQFLNDRLASYLEKVRSLEETNAELESR IQEQCEQDIPMVCPDYQRYFNTIEDLQQKILCTKAENSRLAVQLDNCKLATDDFKSKYES ELSLRQLLEADISSLHGILEELTLCKSDLEAHVESLKEDLLCLKKNHEEEVNLLREQLGD RLSVELDTAPTLDLNRVLDEMRCQCETVLANNRREAEEWLAVQTEELNQQQLSSAEQLQG CQMEILELKRTASALEIELQAQQSLTESLECTVAETEAQYSSQLAQIQCLIDNLENQLAE IRCDLERQNQEYQVLLDVKARLEGEINTYWGLLDSEDSRLSCSPCSTTCTSSNTCEPCSA YVICTVENCCL
Function	May play a role in late hair differentiation.
Tissue Specificity	Expressed in skin and scalp. Also very weakly expressed in tongue, breast, colon and small intestine. In the hair follicle, it is specifically present in the upper hair cuticle. Not present in the upper cortex (at protein level).
KEGG Pathway	Estrogen sig.ling pathway (hsa04915 ) Staphylococcus aureus infection (hsa05150 )
Reactome Pathway	Formation of the cornified envelope (R-HSA-6809371 ) Keratinization (R-HSA-6805567 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Gastric cancer	DISXGOUK	Definitive	Biomarker	[1]
Stomach cancer	DISKIJSX	Definitive	Biomarker	[1]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Keratin, type I cytoskeletal 40 (KRT40).	[3]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Keratin, type I cytoskeletal 40 (KRT40).	[4]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Keratin, type I cytoskeletal 40 (KRT40).	[5]
------------------------------------------------------------------------------------

References

1	Identification of biomarkers associated with histological grade and prognosis of gastric cancer by co-expression network analysis.Oncol Lett. 2019 Nov;18(5):5499-5507. doi: 10.3892/ol.2019.10869. Epub 2019 Sep 13.
2	A combined gene expression tool for parallel histological prediction and gene fusion detection in non-small cell lung cancer.Sci Rep. 2019 Mar 26;9(1):5207. doi: 10.1038/s41598-019-41585-4.
3	Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
4	Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.