Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT30T67V)

• DOT Name: Leucine-rich single-pass membrane protein 1 (LSMEM1)
• Gene Name: LSMEM1
• UniProt ID: LSME1_HUMAN
• Pfam ID: PF15145
• Sequence:
  MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSR
  SLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRL
  NQLNQLDSEQN

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[10]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[5]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[6]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[7]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[11]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Leucine-rich single-pass membrane protein 1 (LSMEM1).	[12]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Targeting MYC dependence in cancer by inhibiting BET bromodomains. Proc Natl Acad Sci U S A. 2011 Oct 4;108(40):16669-74. doi: 10.1073/pnas.1108190108. Epub 2011 Sep 26.
• [10] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [11] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [12] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.