Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3X7T0F)

• DOT Name: Small integral membrane protein 15 (SMIM15)
• Gene Name: SMIM15
• UniProt ID: SIM15_HUMAN
• Pfam ID: PF15086
• Sequence:
  MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQK
  RQENIAKAKRLKKD

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Small integral membrane protein 15 (SMIM15).	[1]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Small integral membrane protein 15 (SMIM15).	[1]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Small integral membrane protein 15 (SMIM15).	[3]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Small integral membrane protein 15 (SMIM15).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Small integral membrane protein 15 (SMIM15).	[2]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [4] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.