Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT425SIG)
DOT Name | Leydig cell tumor 10 kDa protein homolog (C19ORF53) | ||||
---|---|---|---|---|---|
Gene Name | C19ORF53 | ||||
Related Disease | |||||
UniProt ID | |||||
3D Structure | |||||
PDB ID | |||||
Pfam ID | |||||
Sequence |
MAQGQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKK
IEHDVVMKASSSLPKKLALLKAPAKKKGAAAATSSKTPS |
||||
Function | May have a potential role in hypercalcemia of malignancy. | ||||
Molecular Interaction Atlas (MIA) of This DOT
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||
References