Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4GKX8W)

DOT Name	Uncharacterized protein C9orf153 (C9ORF153)
Gene Name	C9ORF153
Related Disease	Acute myelogenous leukaemia ( )
UniProt ID	CI153_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF17673
Sequence	MFLTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARN LNVMSFTRGADVRGDLQPVISVNKMNKPGKHRKTPSPKINK

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Uncharacterized protein C9orf153 (C9ORF153).	[2]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Uncharacterized protein C9orf153 (C9ORF153).	[3]
------------------------------------------------------------------------------------

References

1	Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
2	Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
3	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.