Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT50C1P7)

• DOT Name: Late cornified envelope protein 2A (LCE2A)
• Synonyms: Late envelope protein 9
• Gene Name: LCE2A
• UniProt ID: LCE2A_HUMAN
• Pfam ID: PF14672
• Sequence:
  MSCQQNQQQCQPPPKCPPKCPPKCPPKCRPQCPAPCPPPVSSCCGPSSGGCCGSSSGGCC
  SSGGGGCCLSHHRPRLFHRHRHQSPDCCECEPSGGSGCCHSSGDCC
• Function: Precursors of the cornified envelope of the stratum corneum.
• Tissue Specificity: Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta.
• Reactome Pathway: Formation of the cornified envelope (R-HSA-6809371)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Late cornified envelope protein 2A (LCE2A).	[1]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Late cornified envelope protein 2A (LCE2A).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Late cornified envelope protein 2A (LCE2A).	[2]

References

• [1] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.