Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT50KJQ6)

• DOT Name: DDB1- and CUL4-associated factor 4-like protein 1 (DCAF4L1)
• Synonyms: WD repeat-containing protein 21B
• Gene Name: DCAF4L1
• UniProt ID: DC4L1_HUMAN
• Sequence:
  MEAERLRLLEEEAKLKKVARMGFNASSMLRKSQLGFLNVTSYSRLANELRVSCMERKKVQ
  IRSLDPSSLASDRFNFILASTNSDQLFVVNQVEVEGSKYGIISLRTLKIPSFHVYVLRNL
  YVPNRKVKSLCWASLNQLDSHVLLCFEGITDAPSCAVLLPASRFLSVHTRVNQPGMLCSF
  QIPEAWSCAWSLNTRAYHCFSAGLSQQVLLTSVATGHQQSFDTSSDVLAQQFASTAPLLF
  NGCRSGEIFAIDLRCRNRGKGWRATRLFHDSAVTSVQILQEEQCLMASDMTGKIKLWDLR
  ATKCVRQYEGHVNESAYLPLHVHEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASE
  DDIPSVAFASRLGGIRGAAPGLLMAVRQDLYCFPFS

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of DDB1- and CUL4-associated factor 4-like protein 1 (DCAF4L1).	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of DDB1- and CUL4-associated factor 4-like protein 1 (DCAF4L1).	[2]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of DDB1- and CUL4-associated factor 4-like protein 1 (DCAF4L1).	[3]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of DDB1- and CUL4-associated factor 4-like protein 1 (DCAF4L1).	[4]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of DDB1- and CUL4-associated factor 4-like protein 1 (DCAF4L1).	[5]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [4] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [5] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.