Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT51CU4J)

DOT Name Armadillo-like helical domain-containing protein 3 (ARMH3)
Gene Name ARMH3
Related Disease
Atrial fibrillation ( )
Familial atrial fibrillation ( )
Enterovirus infection ( )
UniProt ID
ARMD3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF08427
Sequence
MAQVEKRGGLLRKSSASKKPLKEKVVLMYDEIFMTEDPSKCSPRFWEELFLMKVNLEYLE
GKLESLDGEELMKIKDNINCLFQHCIQALGEEHPIRVVNALQTLCALIRGVHQKNKSTSG
FDIINMLMGFDKAELCMKNLMESLDSLLCAEGSESLKSLCLKLLLCLVTVTDNISQNTIL
EYVMINSIFEAILQILSHPPSRREHGYDAVVLLALLVNYRKYESVNPYIVKLSIVDDEAT
LNGMGLVIAQALSEYNRQYKDKEEEHQSGFFSALTNMVGSMFIADAHEKISVQTNEAILL
ALYEAVHLNRNFITVLAQSHPEMGLVTTPVSPAPTTPVTPLGTTPPSSDVISSVELPLDA
DVQTSNLLITFLKYSSIVMQDTKDEHRLHSGKLCLIILTCIAEDQYANAFLHDDNMNFRV
NLHRMPMRHRKKAADKNLPCRPLVCAVLDLMVEFIVTHMMKEFPMDLYIRCIQVVHKLLC
YQKKCRVRLHYTWRELWSALINLLKFLMSNETVLLAKHNIFTLALMIVNLFNMFITYGDT
FLPTPSSYDELYYEIIRMHQSFDNLYSMVLRLSTNAGQWKEAASKVTHALVNIRAIINHF
NPKIESYAAVNHISQLSEEQVLEVVRANYDTLTLKLQDGLDQYERYSEQHKEAAFFKELV
RSISTNVRRNLAFHTLSQEVLLKEFSTIS
Function Involved in GBF1 recruitment, Golgi maintenance and protein secretion.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Atrial fibrillation DIS15W6U Strong Genetic Variation [1]
Familial atrial fibrillation DISL4AGF moderate Biomarker [1]
Enterovirus infection DISH2UDP Limited Altered Expression [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Armadillo-like helical domain-containing protein 3 (ARMH3). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Armadillo-like helical domain-containing protein 3 (ARMH3). [4]
Arsenic DMTL2Y1 Approved Arsenic affects the expression of Armadillo-like helical domain-containing protein 3 (ARMH3). [5]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Armadillo-like helical domain-containing protein 3 (ARMH3). [6]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Armadillo-like helical domain-containing protein 3 (ARMH3). [9]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Armadillo-like helical domain-containing protein 3 (ARMH3). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Armadillo-like helical domain-containing protein 3 (ARMH3). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Armadillo-like helical domain-containing protein 3 (ARMH3). [8]
------------------------------------------------------------------------------------

References

1 Multi-ethnic genome-wide association study for atrial fibrillation.Nat Genet. 2018 Jun 11;50(9):1225-1233. doi: 10.1038/s41588-018-0133-9.
2 Characterization of the c10orf76-PI4KB complex and its necessity for Golgi PI4P levels and enterovirus replication.EMBO Rep. 2020 Feb 5;21(2):e48441. doi: 10.15252/embr.201948441. Epub 2019 Dec 12.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
6 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
7 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
9 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
10 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.