Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5E3M4G)

• DOT Name: Uncharacterized protein C2orf72 (C2ORF72)
• Gene Name: C2ORF72
• UniProt ID: CB072_HUMAN
• Pfam ID: PF15443
• Sequence:
  MERELEALAARLARPAEPPFQALVEAAGGRGQVLLVGELWEREQSRALLRDFARAVFPPE
  PGAAKPGGAAAEGAGPGAARGAQRAARAAGAAGAAAAAARAIRSPLVFVLCRASSLAARE
  PRRRLREMLRDVRGRRRAGAALVGVLVAEAGPEDAVAPGLRLLEALLRAVFGRQAGGPVQ
  AAAYCPGLPASCLAVQAAACRALQAAGAGQPVEGAWERPGLPGLLACFSWGPWSRRKNQD
  VAACRSSAQEDFQEPEEELPLTAIFPNGDCDDLGRGSKACDGVVHTPAEPTGDSR

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Uncharacterized protein C2orf72 (C2ORF72).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Uncharacterized protein C2orf72 (C2ORF72).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Uncharacterized protein C2orf72 (C2ORF72).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Uncharacterized protein C2orf72 (C2ORF72).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Uncharacterized protein C2orf72 (C2ORF72).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Uncharacterized protein C2orf72 (C2ORF72).	[7]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Uncharacterized protein C2orf72 (C2ORF72).	[6]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Uncharacterized protein C2orf72 (C2ORF72).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Uncharacterized protein C2orf72 (C2ORF72).	[9]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [8] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [9] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.