Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5FSOD8)

• DOT Name: C-C chemokine receptor type 9 (CCR9)
• Synonyms: C-C CKR-9; CC-CKR-9; CCR-9; G-protein coupled receptor 28; GPR-9-6; CD antigen CDw199
• Gene Name: CCR9
• UniProt ID: CCR9_HUMAN
• PDB ID: 5LWE
• Pfam ID: PF00001
• Sequence:
  MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFI
  VGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCK
  VVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALC
  IPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHT
  LIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
  VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
  ETTSGALSL
• Function: Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level; (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.
• Tissue Specificity: Highly expressed in the thymus and low in lymph nodes and spleen.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine sig.ling pathway (hsa04062)
  Intesti.l immune network for IgA production (hsa04672)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Clavulanate	DM2FGRT	Approved	C-C chemokine receptor type 9 (CCR9) increases the Liver injury ADR of Clavulanate.	[4]
Amoxicillin	DMUYNEI	Approved	C-C chemokine receptor type 9 (CCR9) increases the Liver injury ADR of Amoxicillin.	[4]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of C-C chemokine receptor type 9 (CCR9).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of C-C chemokine receptor type 9 (CCR9).	[2]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of C-C chemokine receptor type 9 (CCR9).	[3]

References

• [1] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [2] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [3] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [4] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.