Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5VU4NC)

• DOT Name: Isoamyl acetate-hydrolyzing esterase 1 homolog (IAH1)
• Synonyms: EC 3.1.-.-
• Gene Name: IAH1
• UniProt ID: IAH1_HUMAN
• EC Number: 3.1.-.-
• Pfam ID: PF00657
• Sequence:
  MALCEAAGCGSALLWPRLLLFGDSITQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTR
  WAKIILPRLIRKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLEEYAANLKSMVQYLKS
  VDIPENRVILITPTPLCETAWEEQCIIQGCKLNRLNSVVGEYANACLQVAQDCGTDVLDL
  WTLMQDSQDFSSYLSDGLHLSPKGNEFLFSHLWPLIEKKVSSLPLLLPYWRDVAEAKPEL
  SLLGDGDH
• Function: Probable lipase.

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Isoamyl acetate-hydrolyzing esterase 1 homolog (IAH1).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Isoamyl acetate-hydrolyzing esterase 1 homolog (IAH1).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Isoamyl acetate-hydrolyzing esterase 1 homolog (IAH1).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Isoamyl acetate-hydrolyzing esterase 1 homolog (IAH1).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Isoamyl acetate-hydrolyzing esterase 1 homolog (IAH1).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Isoamyl acetate-hydrolyzing esterase 1 homolog (IAH1).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Isoamyl acetate-hydrolyzing esterase 1 homolog (IAH1).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Isoamyl acetate-hydrolyzing esterase 1 homolog (IAH1).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.