Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5WAX2N)

DOT Name	7-methylguanosine phosphate-specific 5'-nucleotidase (NT5C3B)
Synonyms	7-methylguanosine nucleotidase; EC 3.1.3.91; Cytosolic 5'-nucleotidase 3B; Cytosolic 5'-nucleotidase III-like protein; cN-III-like protein; EC 3.1.3.5; N(7)-methylguanylate 5'-phosphatase
Gene Name	NT5C3B
Related Disease	Amyotrophic lateral sclerosis ( )
UniProt ID	5NT3B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	7ZEE; 7ZEG; 7ZEH
EC Number	3.1.3.5; 3.1.3.91
Pfam ID	PF05822
Sequence	MAEEVSTLMKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFAYNGKRCPSSY NILDNSKIISEECRKELTALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQK FQIAQVVRESNAMLREGYKTFFNTLYHNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIV SNYMDFNEDGFLQGFKGQLIHTYNKNSSACENSGYFQQLEGKTNVILLGDSIGDLTMADG VPGVQNILKIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNGLLQHILCQGVQLEMQGP
Function	Specifically hydrolyzes 7-methylguanosine monophosphate (m(7)GMP) to 7-methylguanosine and inorganic phosphate. The specific activity for m(7)GMP may protect cells against undesired salvage of m(7)GMP and its incorporation into nucleic acids. Also has weak activity for CMP. UMP and purine nucleotides are poor substrates.
KEGG Pathway	Pyrimidine metabolism (hsa00240 ) Metabolic pathways (hsa01100 ) Nucleotide metabolism (hsa01232 )
Reactome Pathway	mRNA decay by 3' to 5' exoribonuclease (R-HSA-429958 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of 7-methylguanosine phosphate-specific 5'-nucleotidase (NT5C3B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of 7-methylguanosine phosphate-specific 5'-nucleotidase (NT5C3B).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of 7-methylguanosine phosphate-specific 5'-nucleotidase (NT5C3B).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of 7-methylguanosine phosphate-specific 5'-nucleotidase (NT5C3B).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of 7-methylguanosine phosphate-specific 5'-nucleotidase (NT5C3B).	[6]
------------------------------------------------------------------------------------

References

1	A Genome-wide Expression Association Analysis Identifies Genes and Pathways Associated with Amyotrophic Lateral Sclerosis.Cell Mol Neurobiol. 2018 Apr;38(3):635-639. doi: 10.1007/s10571-017-0512-2. Epub 2017 Jun 21.
2	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
3	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.