Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT60GBZQ)

• DOT Name: Coiled-coil domain-containing protein 9B (CCDC9B)
• Gene Name: CCDC9B
• UniProt ID: CCD9B_HUMAN
• Pfam ID: PF15266
• Sequence:
  MISCAEQRSRQGEAGRGPAPVAPAFLPLWLPRGCSGILSVPAVAMHSAGTPRAESPMSRQ
  EKDAELDRRIVALRKKNQALLRRYQEIQEDRRQAEQGGMAVTTPALLQPDGLTVTISQVP
  GEKRVVSRNWARGTCGPRVTNEMLEDEDAEDHGGTFCLGELVELAVTMENKAEGKRIVSE
  KPTRARNQGIEGSPGGRVTRSPPTQVAISSDSARKGSWEPWSRPVGEPPEAGWDYAQWKQ
  EREQIDLARLARHRDAQGDWRRPWDLDKAKSTLQDCSQLRGEGPARAGSRRGPRSHQKLQ
  PPPLLPDGKGRGGQASRPSVAPATGSKARGKERLTGRARRWDMKEDKEELEGQEGSQSTR
  ETPSEEEQAQKQSGMEQGRLGSAPAASPALASPEGPKGESVASTASSVPCSPQEPDLAPL
  DLSLGGAGIPGPRESGCVLGLRPGAQESPVSWPEGSKQQPLGWSNHQAELEVQTCPEPQR
  GAGLPEPGEDRSGKSGAQQGLAPRSRPTRGGSQRSRGTAGVRRRTGRPGPAGRC

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Coiled-coil domain-containing protein 9B (CCDC9B).	[1]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[6]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[7]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[12]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Coiled-coil domain-containing protein 9B (CCDC9B).	[13]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [7] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [10] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [13] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.