Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT64M0K7)

• DOT Name: Insulin growth factor-like family member 2 (IGFL2)
• Gene Name: IGFL2
• UniProt ID: IGFL2_HUMAN
• Pfam ID: PF14653
• Sequence:
  MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSL
  SETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP
• Function: Potential ligand of the IGFLR1 cell membrane receptor.
• Tissue Specificity: Detected in cerebellum, heart, placenta, spleen, stomach, testis and thymus.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Insulin growth factor-like family member 2 (IGFL2).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Insulin growth factor-like family member 2 (IGFL2).	[2]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Insulin growth factor-like family member 2 (IGFL2).	[3]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of Insulin growth factor-like family member 2 (IGFL2).	[4]
LY2835219	DM93VBZ	Approved	LY2835219 increases the expression of Insulin growth factor-like family member 2 (IGFL2).	[5]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Insulin growth factor-like family member 2 (IGFL2).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Insulin growth factor-like family member 2 (IGFL2).	[7]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Insulin growth factor-like family member 2 (IGFL2).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Insulin growth factor-like family member 2 (IGFL2).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [4] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [5] Biological specificity of CDK4/6 inhibitors: dose response relationship, in vivo signaling, and composite response signature. Oncotarget. 2017 Jul 4;8(27):43678-43691. doi: 10.18632/oncotarget.18435.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [9] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.