Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT64NCZ6)

DOT Name Probable ATP-dependent RNA helicase DDX27 (DDX27)
Synonyms EC 3.6.4.13; DEAD box protein 27
Gene Name DDX27
Related Disease
Advanced cancer ( )
Gastric cancer ( )
Neoplasm ( )
Stomach cancer ( )
Colorectal carcinoma ( )
UniProt ID
DDX27_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.6.4.13
Pfam ID
PF00270 ; PF00271
Sequence
MVLAQRRRGGCEKLRAGPQAVLASGSGFCDNMLADLGLIGTIGEDDEVPVEPESDSGDEE
EEGPIVLGRRQKALGKNRSADFNPDFVFTEKEGTYDGSWALADVMSQLKKKRAATTLDEK
IEKVRKKRKTEDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADE
NILTKADTLKVKDRKKKKKKGQEAGGFFEDASQYDENLSFQDMNLSRPLLKAITAMGFKQ
PTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRE
LGIQVHSVTRQLAQFCNITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSF
HLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNP
VRIFVNSNTDVAPFLRQEFIRIRPNREGDREAIVAALLTRTFTDHVMLFTQTKKQAHRMH
ILLGLMGLQVGELHGNLSQTQRLEALRRFKDEQIDILVATDVAARGLDIEGVKTVINFTM
PNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEIVKAAKAPVKARILPQDVILKFR
DKIEKMEKDVYAVLQLEAEEKEMQQSEAQINTAKRLLEKGKEAVVQEPERSWFQTKEERK
KEKIAKALQEFDLALRGKKKRKKFMKDAKKKGEMTAEERSQFEILKAQMFAERLAKRNRR
AKRARAMPEEEPVRGPAKKQKQGKKSVFDEELTNTSKKALKQYRAGPSFEERKQLGLPHQ
RRGGNFKSKSRYKRRK
Function Probable ATP-dependent RNA helicase. Component of the nucleolar ribosomal RNA (rRNA) processing machinery that regulates 3' end formation of ribosomal 47S rRNA.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Gastric cancer DISXGOUK Strong Altered Expression [2]
Neoplasm DISZKGEW Strong Biomarker [3]
Stomach cancer DISKIJSX Strong Altered Expression [2]
Colorectal carcinoma DIS5PYL0 Limited Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Probable ATP-dependent RNA helicase DDX27 (DDX27). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Probable ATP-dependent RNA helicase DDX27 (DDX27). [5]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Probable ATP-dependent RNA helicase DDX27 (DDX27). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Probable ATP-dependent RNA helicase DDX27 (DDX27). [7]
Haloperidol DM96SE0 Approved Haloperidol increases the expression of Probable ATP-dependent RNA helicase DDX27 (DDX27). [9]
Afimoxifene DMFORDT Phase 2 Afimoxifene decreases the expression of Probable ATP-dependent RNA helicase DDX27 (DDX27). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Probable ATP-dependent RNA helicase DDX27 (DDX27). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Probable ATP-dependent RNA helicase DDX27 (DDX27). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Probable ATP-dependent RNA helicase DDX27 (DDX27). [8]
------------------------------------------------------------------------------------

References

1 DEAD-box helicase 27 plays a tumor-promoter role by regulating the stem cell-like activity of human colorectal cancer cells.Onco Targets Ther. 2018 Dec 28;12:233-241. doi: 10.2147/OTT.S190814. eCollection 2019.
2 An integrative approach identified genes associated with drug response in gastric cancer.Carcinogenesis. 2015 Apr;36(4):441-51. doi: 10.1093/carcin/bgv014. Epub 2015 Mar 5.
3 DEAD-box helicase 27 promotes colorectal cancer growth and metastasis and predicts poor survival in CRC patients.Oncogene. 2018 May;37(22):3006-3021. doi: 10.1038/s41388-018-0196-1. Epub 2018 Mar 14.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Identification of novel ER-alpha target genes in breast cancer cells: gene- and cell-selective co-regulator recruitment at target promoters determines the response to 17beta-estradiol and tamoxifen. Mol Cell Endocrinol. 2010 Jan 15;314(1):90-100.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
9 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
10 Comparison of quantitation methods in proteomics to define relevant toxicological information on AhR activation of HepG2 cells by BaP. Toxicology. 2021 Jan 30;448:152652. doi: 10.1016/j.tox.2020.152652. Epub 2020 Dec 2.
11 Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.