Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6K6D84)

• DOT Name: Uncharacterized protein C12orf60 (C12ORF60)
• Gene Name: C12ORF60
• UniProt ID: CL060_HUMAN
• Pfam ID: PF15047
• Sequence:
  MSSESEKDKERLIQAAKMFFFHVQDLASVINTLTELFSRSMNTQILLMAVKNNSYIKDFF
  EQMLKIFKEMQSVVDARHDKIQKESLCSKVAMAMCSVVQKSTNVEELHQSAKEVFKSAHT
  PVIISVLNSSNILGSLESSLSHLMKFPIMNLQLSDFYTEDTKEQSDVTTSERTRSPPGSS
  KTTMIDTLKKLQDVLKTEDSKNPTKSAADLLEQIVKAMGPILEILQKAIKTMEMNISVFK
  KASDK

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Uncharacterized protein C12orf60 (C12ORF60).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Uncharacterized protein C12orf60 (C12ORF60).	[2]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Uncharacterized protein C12orf60 (C12ORF60).	[3]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Uncharacterized protein C12orf60 (C12ORF60).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Uncharacterized protein C12orf60 (C12ORF60).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Uncharacterized protein C12orf60 (C12ORF60).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Uncharacterized protein C12orf60 (C12ORF60).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Uncharacterized protein C12orf60 (C12ORF60).	[7]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [4] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.