| DOT Name |
Tubulin alpha-3E chain
|
| Synonyms |
EC 3.6.5.-; Alpha-tubulin 3E |
| Gene Name |
TUBA3E
|
| Related Disease |
- Complex neurodevelopmental disorder ( )
|
| UniProt ID |
|
| 3D Structure |
|
| EC Number |
|
| Pfam ID |
|
| Sequence |
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYSKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLVHKFDLMYAKWAFVHWYVGEGMEEGEFSE
AREDLAALEKDCEEVGVDSVEAEAEEGEAY
|
| Function |
Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin.
|
| KEGG Pathway |
- Phagosome (hsa04145 )
- Apoptosis (hsa04210 )
- Tight junction (hsa04530 )
- Gap junction (hsa04540 )
- Motor proteins (hsa04814 )
- Alzheimer disease (hsa05010 )
- Parkinson disease (hsa05012 )
- Amyotrophic lateral sclerosis (hsa05014 )
- Huntington disease (hsa05016 )
- Prion disease (hsa05020 )
- Pathways of neurodegeneration - multiple diseases (hsa05022 )
- Pathogenic Escherichia coli infection (hsa05130 )
- Salmonella infection (hsa05132 )
|
| Reactome Pathway |
- Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane (R-HSA-190840 )
- Gap junction assembly (R-HSA-190861 )
- MHC class II antigen presentation (R-HSA-2132295 )
- Separation of Sister Chromatids (R-HSA-2467813 )
- Resolution of Sister Chromatid Cohesion (R-HSA-2500257 )
- HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand (R-HSA-3371497 )
- Recruitment of NuMA to mitotic centrosomes (R-HSA-380320 )
- Formation of tubulin folding intermediates by CCT/TriC (R-HSA-389960 )
- Post-chaperonin tubulin folding pathway (R-HSA-389977 )
- Recycling pathway of L1 (R-HSA-437239 )
- Cilium Assembly (R-HSA-5617833 )
- RHO GTPases activate IQGAPs (R-HSA-5626467 )
- RHO GTPases Activate Formins (R-HSA-5663220 )
- COPI-mediated anterograde transport (R-HSA-6807878 )
- COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434 )
- COPI-independent Golgi-to-ER retrograde traffic (R-HSA-6811436 )
- Mitotic Prometaphase (R-HSA-68877 )
- The role of GTSE1 in G2/M progression after G2 checkpoint (R-HSA-8852276 )
- Carboxyterminal post-translational modifications of tubulin (R-HSA-8955332 )
- HCMV Early Events (R-HSA-9609690 )
- Assembly and cell surface presentation of NMDA receptors (R-HSA-9609736 )
- Activation of AMPK downstream of NMDARs (R-HSA-9619483 )
- Aggrephagy (R-HSA-9646399 )
- EML4 and NUDC in mitotic spindle formation (R-HSA-9648025 )
- Sealing of the nuclear envelope (NE) by ESCRT-III (R-HSA-9668328 )
- Kinesins (R-HSA-983189 )
- PKR-mediated signaling (R-HSA-9833482 )
- Translocation of SLC2A4 (GLUT4) to the plasma membrane (R-HSA-1445148 )
|
|
|
|
|
|
|
