Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT72NQLJ)

DOT Name	Golgin subfamily A member 7 (GOLGA7)
Synonyms	Golgi complex-associated protein of 16 kDa
Gene Name	GOLGA7
Related Disease	Glioma ( ) Advanced cancer ( ) Non-hodgkin lymphoma ( )
UniProt ID	GOGA7_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	8HF3
Pfam ID	PF10256
Sequence	MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKL GGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL RVIEITIYEDRGMSSGR
Function	May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
Tissue Specificity	Expressed in all tissues except colon and thymus.
Reactome Pathway	RAS processing (R-HSA-9648002 ) Maturation of spike protein (R-HSA-9694548 ) Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Glioma	DIS5RPEH	Strong	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	moderate	Genetic Variation	[2]
Non-hodgkin lymphoma	DISS2Y8A	moderate	Genetic Variation	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Golgin subfamily A member 7 (GOLGA7).	[3]
------------------------------------------------------------------------------------

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Golgin subfamily A member 7 (GOLGA7).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Golgin subfamily A member 7 (GOLGA7).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Golgin subfamily A member 7 (GOLGA7).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Golgin subfamily A member 7 (GOLGA7).	[7]
------------------------------------------------------------------------------------

References

1	GOLGA7 rs11337, a Polymorphism at the MicroRNA Binding Site, Is Associated with Glioma Prognosis.Mol Ther Nucleic Acids. 2019 Dec 6;18:56-65. doi: 10.1016/j.omtn.2019.08.006. Epub 2019 Aug 14.
2	A polymorphism at the microRNA binding site in the 3' untranslated region of C14orf101 is associated with non-Hodgkin lymphoma overall survival.Cancer Genet. 2014 Apr;207(4):141-6. doi: 10.1016/j.cancergen.2014.03.007. Epub 2014 Mar 22.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.