Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7G17V5)

• DOT Name: Hippocampus abundant transcript 1 protein (MFSD14A)
• Synonyms: Major facilitator superfamily domain-containing 14A; Putative tetracycline transporter-like protein
• Gene Name: MFSD14A
• Related Disease: Clear cell renal carcinoma
• UniProt ID: MF14A_HUMAN
• Pfam ID: PF07690
• Sequence:
  MTQGKKKKRAANRSIMLAKKIIIKDGGTPQGIGSPSVYHAVIVIFLEFFAWGLLTAPTLV
  VLHETFPKHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLLLTVFFTCAPIPLMK
  ISPWWYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAY
  LGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASWGAPISWEQADPFASLKKV
  GQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKFSPESVAAFIAVLGILSIIAQTIV
  LSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAMSSITFPAVSALVSR
  TADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVELKELPITGTDLGTNTSPQHHF
  EQNSIIPGPPFLFGACSVLLALLVALFIPEHTNLSLRSSSWRKHCGSHSHPHNTQAPGEA
  KEPLLQDTNV

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Clear cell renal carcinoma	DISBXRFJ	Limited	Biomarker	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Hippocampus abundant transcript 1 protein (MFSD14A).	[2]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Hippocampus abundant transcript 1 protein (MFSD14A).	[3]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Hippocampus abundant transcript 1 protein (MFSD14A).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Hippocampus abundant transcript 1 protein (MFSD14A).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Hippocampus abundant transcript 1 protein (MFSD14A).	[6]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Hippocampus abundant transcript 1 protein (MFSD14A).	[7]

References

• [1] Androgen receptor (AR) promotes clear cell renal cell carcinoma (ccRCC) migration and invasion via altering the circHIAT1/miR-195-5p/29a-3p/29c-3p/CDC42 signals.Cancer Lett. 2017 May 28;394:1-12. doi: 10.1016/j.canlet.2016.12.036. Epub 2017 Jan 13.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [4] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [7] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.