Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7HTDKK)

• DOT Name: Neuritin-like protein (NRN1L)
• Gene Name: NRN1L
• UniProt ID: NRN1L_HUMAN
• Pfam ID: PF15056
• Sequence:
  MMRCCRRRCCCRQPPHALRPLLLLPLVLLPPLAAAAAGPNRCDTIYQGFAECLIRLGDSM
  GRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVH
  VRERGTGSETNQETLRATAPALPMAPAPPLLAAALALAYLLRPLA
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Neuritin-like protein (NRN1L).	[1]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Neuritin-like protein (NRN1L).	[1]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Neuritin-like protein (NRN1L).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Neuritin-like protein (NRN1L).	[2]

References

• [1] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.