Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7JDVA7)

• DOT Name: Oxidative stress-induced growth inhibitor 2 (OSGIN2)
• Synonyms: hT41
• Gene Name: OSGIN2
• UniProt ID: OSGI2_HUMAN
• Sequence:
  MPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEA
  RHLSIVDQDLEYLSEGLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHV
  VLGKGPPGGAWHNMEGSMLTISFGSWMELPGLKFKDWVSSKRRSLKGDRVMPEEIARYYK
  HYVKVMGLQKNFRENTYITSVSRLYRDQDDDDIQDRDISTKHLQIEKSNFIKRNWEIRGY
  QRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGK
  VDPVLIVGSGLTAADAVLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMM
  CTQSYSVDSNLLSDYTSFPEHRVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLS
  FLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALG
  VTRCLATRQKKKHLFVERGGGDGIA
• Function: May be involved in meiosis or the maturation of germ cells.
• Tissue Specificity: Ubiquitous. Expressed at higher levels in testis and ovary.

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[6]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[7]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[10]
Milchsaure	DM462BT	Investigative	Milchsaure affects the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[11]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Oxidative stress-induced growth inhibitor 2 (OSGIN2).	[8]

References

• [1] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [12] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.